(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE98

ACCPU_3.PE98         Location/Qualifiers
FT   CDS             complement(108857..109732)
FT                   /locus_tag="CAP2UW1_4674"
FT                   /gene_family="HOG000263697" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091603"
FT                   /db_xref="GeneID:8402105"
FT                   /translation="MSSNKLTRATQEPAWVRYTLLTVGLGFLFFFLGLPLVAVFVEALA
FT                   QGLPIYLEALKESETRSAIWLTIVIALAVLPFNILFGVAAAWAIAKFEFKGKSLLITLI
FT                   DLPFAVSPVVAGLIFILMFGSQGYFGGLLAAKDVKIIFAVPGMILATLFITFPFIAREL
FT                   IPLMQSQGKDEEEAAISLGASGWQMFWRVTLPNIKWGLLYGVILSNARAMGEFGAVSVV
FT                   SGHIRGETNTLPLHVEILYNEYNAIGAFAAASVLALLALVTLVAKTIVEWRMKAETDML
FT                   NAELPGEKTS"
FT                   /protein_id="YP_003165246.1"
     MSSNKLTRAT QEPAWVRYTL LTVGLGFLFF FLGLPLVAVF VEALAQGLPI YLEALKESET        60
     RSAIWLTIVI ALAVLPFNIL FGVAAAWAIA KFEFKGKSLL ITLIDLPFAV SPVVAGLIFI       120
     LMFGSQGYFG GLLAAKDVKI IFAVPGMILA TLFITFPFIA RELIPLMQSQ GKDEEEAAIS       180
     LGASGWQMFW RVTLPNIKWG LLYGVILSNA RAMGEFGAVS VVSGHIRGET NTLPLHVEIL       240
     YNEYNAIGAF AAASVLALLA LVTLVAKTIV EWRMKAETDM LNAELPGEKT S                291
//

If you have problems or comments...

PBIL Back to PBIL home page