(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE99

ACCPU_3.PE99         Location/Qualifiers
FT   CDS             complement(109729..110604)
FT                   /locus_tag="CAP2UW1_4675"
FT                   /gene_family="HOG000263698" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091604"
FT                   /db_xref="GeneID:8402039"
FT                   /translation="MSAKSQRVLPGFGLALGYTLVYLSLLILLPLGGMILKASELGFGQ
FT                   ILDIALGERSLAAFRVTFVSSLLAASINAFFGLIVAWILVRYSFPGKRFVDALVDLPFA
FT                   LPTAVAGITLATLYAGNGWLGQYLEPLGVKVAYTPLGIIVALTFITLPFVVRTLQPVIE
FT                   DIETEVEEAAASLGASRWQTFVKAIFPAIGPALLTGFALAFARALGEFGSVIFIAGNLP
FT                   LISEIVPLLIISKLEQYDVLGATALAVVMLAISFVLLLVINALQWWAANRHKNSEPLEV
FT                   AAGKTKAGAA"
FT                   /protein_id="YP_003165247.1"
     MSAKSQRVLP GFGLALGYTL VYLSLLILLP LGGMILKASE LGFGQILDIA LGERSLAAFR        60
     VTFVSSLLAA SINAFFGLIV AWILVRYSFP GKRFVDALVD LPFALPTAVA GITLATLYAG       120
     NGWLGQYLEP LGVKVAYTPL GIIVALTFIT LPFVVRTLQP VIEDIETEVE EAAASLGASR       180
     WQTFVKAIFP AIGPALLTGF ALAFARALGE FGSVIFIAGN LPLISEIVPL LIISKLEQYD       240
     VLGATALAVV MLAISFVLLL VINALQWWAA NRHKNSEPLE VAAGKTKAGA A                291
//

If you have problems or comments...

PBIL Back to PBIL home page