(data stored in ACNUC8465 zone)

HOGENOMDNA: ACHXA_1.PE1266

ACHXA_1.PE1266       Location/Qualifiers
FT   CDS             1361814..1362227
FT                   /locus_tag="AXYL_01290"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="endoribonuclease L-PSP family protein 5"
FT                   /transl_table="11"
FT                   /db_xref="GI:311104490"
FT                   /db_xref="GeneID:9895622"
FT                   /translation="MKHKRIRTFNTKATYPEQKLDNDLCQAVVARGSTVFLRGQIGQNL
FT                   DTSESVCIGDAAGQTEQAMKNIDMLLKEAGGELQDICKITIYIIDPRYREEVYRVVGKW
FT                   LKGVFPVSTGIVVSALARPEWLVEIDATAVIPD"
FT                   /protein_id="YP_003977343.1"
     MKHKRIRTFN TKATYPEQKL DNDLCQAVVA RGSTVFLRGQ IGQNLDTSES VCIGDAAGQT        60
     EQAMKNIDML LKEAGGELQD ICKITIYIID PRYREEVYRV VGKWLKGVFP VSTGIVVSAL       120
     ARPEWLVEID ATAVIPD                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page