(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIC5_1.PE1

ACIC5_1.PE1          Location/Qualifiers
FT   CDS             complement(117..764)
FT                   /locus_tag="ACP_0001"
FT                   /gene_family="HOG000257978" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="YkgG family protein"
FT                   /transl_table="11"
FT                   /note="YkgG family protein AMBIGUITY; this gene contains a
FT                   premature stop which is not the result of sequencing error;
FT                   identified by match to protein family HMM PF02589"
FT                   /db_xref="GI:225871700"
FT                   /db_xref="GeneID:7699716"
FT                   /translation="MTQSEARAEILARIQSAVKGNDDRYEPEDSPANYRRAGTLTLPER
FT                   LDLFLERLREYDAQVMSVKAGDVASTIAGVLREADEAALPWVVADGFPAEWLARSPAVM
FT                   PESEAGVDELDRCAGVVTACSVGIAVTGTLVLRHGAGEGRRRTSLIPDRHLCVVRASQV
FT                   VETVPEAFARLADAATEPLTLISGPSATADIEMTRIRGVHGPRQLYVTLVLE"
FT                   /protein_id="YP_002753154.1"
     MTQSEARAEI LARIQSAVKG NDDRYEPEDS PANYRRAGTL TLPERLDLFL ERLREYDAQV        60
     MSVKAGDVAS TIAGVLREAD EAALPWVVAD GFPAEWLARS PAVMPESEAG VDELDRCAGV       120
     VTACSVGIAV TGTLVLRHGA GEGRRRTSLI PDRHLCVVRA SQVVETVPEA FARLADAATE       180
     PLTLISGPSA TADIEMTRIR GVHGPRQLYV TLVLE                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page