(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIC5_1.PE10

ACIC5_1.PE10         Location/Qualifiers
FT   CDS             7314..9761
FT                   /locus_tag="ACP_0010"
FT                   /gene_family="HOG000122165" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative alpha-1,2-mannosidase"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF07971;
FT                   match to protein family HMM TIGR01180; match to protein
FT                   family HMM TIGR01409"
FT                   /db_xref="GI:225871709"
FT                   /db_xref="GeneID:7698253"
FT                   /translation="MKQRAIQRRDFLKACAAAAAASAIPAYGLRWNSAHALLMPATKAA
FT                   GEMQDVLPMIGTGWHGHMFPGAVMPFGMVQLSPDTSGMPEPKWNGKWDITGWDHCSGYH
FT                   YTDNVVQGFSHTHLQGTGASDLGDVLLMPMVKGRNWSWNSGTPAQQAEAQIEALGENSG
FT                   WVMNAGERGYWSFFSHDEEEARPGYYRVHLKTPDVRAELTATTRCGMHRYHYPATGVHG
FT                   LMLDLVHGIGCEVYAAELHVESTTRVRGVRSTHGWAADKQVYFVAEFSRPFASVEVRVD
FT                   GKEQSLQAGDHVAGKQVQAIFTQADSADALVVRVGISATSMEGAAKNLAAEIPHFDFDR
FT                   QRGEAGKAWNDALQVLQADCPTPAMQQTFDTAMYHGLVAPATFNDVDGAYRGQDHKNYP
FT                   NPGFTKYTTLSIWDIYRGEFPFIMLMQPHRVRDIIETLLADYRQLNQNSLPVWPLWGNE
FT                   TWCMTGFHVVGMIVGAYARGFRDFDVDAAYAAMRDTALVGAKANGNFELQQQFRKLGYV
FT                   ASGGRNQSVSRTLDFSYDYWCVGAMAELLGKKDDAAMFYKLGQNYRNIFDPASGFMRGK
FT                   TEEGAWHEPFRPDEEYWQDYTESDAWQATFNVMQDVQGLIGLYGGNDAFIAKLDALFAA
FT                   PSNILNSPPDISGMVGQDAQGNEPSNHIPYLYSFAGAPWKTQERVRQVAALYNNTPAGV
FT                   PGNDDCGQISSWFAFAAMGFYPVNAVTGVYVIGSPMVERAVLRNPKSGTTFTVVTENNS
FT                   ERNLYIQSAEWNGKPLTRCWITHEQILAGGELRFRMGSQPNKRWGSAPEDRPPSGLVHT
FT                   KQM"
FT                   /protein_id="YP_002753163.1"
     MKQRAIQRRD FLKACAAAAA ASAIPAYGLR WNSAHALLMP ATKAAGEMQD VLPMIGTGWH        60
     GHMFPGAVMP FGMVQLSPDT SGMPEPKWNG KWDITGWDHC SGYHYTDNVV QGFSHTHLQG       120
     TGASDLGDVL LMPMVKGRNW SWNSGTPAQQ AEAQIEALGE NSGWVMNAGE RGYWSFFSHD       180
     EEEARPGYYR VHLKTPDVRA ELTATTRCGM HRYHYPATGV HGLMLDLVHG IGCEVYAAEL       240
     HVESTTRVRG VRSTHGWAAD KQVYFVAEFS RPFASVEVRV DGKEQSLQAG DHVAGKQVQA       300
     IFTQADSADA LVVRVGISAT SMEGAAKNLA AEIPHFDFDR QRGEAGKAWN DALQVLQADC       360
     PTPAMQQTFD TAMYHGLVAP ATFNDVDGAY RGQDHKNYPN PGFTKYTTLS IWDIYRGEFP       420
     FIMLMQPHRV RDIIETLLAD YRQLNQNSLP VWPLWGNETW CMTGFHVVGM IVGAYARGFR       480
     DFDVDAAYAA MRDTALVGAK ANGNFELQQQ FRKLGYVASG GRNQSVSRTL DFSYDYWCVG       540
     AMAELLGKKD DAAMFYKLGQ NYRNIFDPAS GFMRGKTEEG AWHEPFRPDE EYWQDYTESD       600
     AWQATFNVMQ DVQGLIGLYG GNDAFIAKLD ALFAAPSNIL NSPPDISGMV GQDAQGNEPS       660
     NHIPYLYSFA GAPWKTQERV RQVAALYNNT PAGVPGNDDC GQISSWFAFA AMGFYPVNAV       720
     TGVYVIGSPM VERAVLRNPK SGTTFTVVTE NNSERNLYIQ SAEWNGKPLT RCWITHEQIL       780
     AGGELRFRMG SQPNKRWGSA PEDRPPSGLV HTKQM                                  815
//

If you have problems or comments...

PBIL Back to PBIL home page