(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIC5_1.PE2

ACIC5_1.PE2          Location/Qualifiers
FT   CDS             complement(751..2181)
FT                   /locus_tag="ACP_0002"
FT                   /gene_family="HOG000262102" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF02589; match to protein
FT                   family HMM TIGR00273"
FT                   /db_xref="GI:225871701"
FT                   /db_xref="GeneID:7699054"
FT                   /translation="MTIRVGDSAEAPSFQKAALPLLKDVQLRKNVRHATEVIQHKRDMV
FT                   AGELPDWQALREAAAAIKRKTLRHLDEYLEQFEAACLAAGGHVHWARDAEEANRIVLEL
FT                   VRQQNAQEVLKIKTMTADETGLNRALEQAGIHPHETDLAELIVQLGEDRPSHIVVPALH
FT                   KNRNQVREIFRDKMQRPDLGASPQDLTEAARQYLREKFLRVKTAIGGANFLIAETGGVC
FT                   IVESEGNGRMCLTLPETLILMVGVEKVIPRFQDLEVFLQLLPRSATGERMNPYNSIWTG
FT                   VHDGDGPKNFHVVLIDNGRTGILADEEARQTLQCIRCGACLNACPVYRQTGGHAYGSTY
FT                   GGPIGAILTPQLQNMEHAQSLPYASSLCGACYEVCPVKINIPEVLIHLRGRVVREQQSA
FT                   LKPETLGMKAVAAVFRSHRRLEAAQRLAQMAQAPLVKDGWIHRLPGELSAWTAARDLQA
FT                   IPKQSFRQWWKETHRDAE"
FT                   /protein_id="YP_002753155.1"
     MTIRVGDSAE APSFQKAALP LLKDVQLRKN VRHATEVIQH KRDMVAGELP DWQALREAAA        60
     AIKRKTLRHL DEYLEQFEAA CLAAGGHVHW ARDAEEANRI VLELVRQQNA QEVLKIKTMT       120
     ADETGLNRAL EQAGIHPHET DLAELIVQLG EDRPSHIVVP ALHKNRNQVR EIFRDKMQRP       180
     DLGASPQDLT EAARQYLREK FLRVKTAIGG ANFLIAETGG VCIVESEGNG RMCLTLPETL       240
     ILMVGVEKVI PRFQDLEVFL QLLPRSATGE RMNPYNSIWT GVHDGDGPKN FHVVLIDNGR       300
     TGILADEEAR QTLQCIRCGA CLNACPVYRQ TGGHAYGSTY GGPIGAILTP QLQNMEHAQS       360
     LPYASSLCGA CYEVCPVKIN IPEVLIHLRG RVVREQQSAL KPETLGMKAV AAVFRSHRRL       420
     EAAQRLAQMA QAPLVKDGWI HRLPGELSAW TAARDLQAIP KQSFRQWWKE THRDAE           476
//

If you have problems or comments...

PBIL Back to PBIL home page