(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIC5_1.PE3

ACIC5_1.PE3          Location/Qualifiers
FT   CDS             complement(2178..2921)
FT                   /locus_tag="ACP_0003"
FT                   /gene_family="HOG000262113" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cysteine-rich domain protein"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF02754"
FT                   /db_xref="GI:225871702"
FT                   /db_xref="GeneID:7701219"
FT                   /translation="MRVSLFITCYNDLLFPETGRSLVRLLERLGHTVEFPREQTCCGQM
FT                   HYNTGYQREAMPLMQRFVEIFQDAEAVCIPSSSCVAMIRDHYPKMAASTGDARLVGAVN
FT                   ALLPRVFEFSELLVHKLGVEDVGAYYPHRVTYHASCHSLRSLQLGDLPLRLLRKVRSID
FT                   LVELPNADRCCGFGGTFAVKNGDVSAEMLAEKMRDVENTGAEVCAAVDNSCLMHIYGGL
FT                   HQRKVGIRTVHLAEILASTEEETVR"
FT                   /protein_id="YP_002753156.1"
     MRVSLFITCY NDLLFPETGR SLVRLLERLG HTVEFPREQT CCGQMHYNTG YQREAMPLMQ        60
     RFVEIFQDAE AVCIPSSSCV AMIRDHYPKM AASTGDARLV GAVNALLPRV FEFSELLVHK       120
     LGVEDVGAYY PHRVTYHASC HSLRSLQLGD LPLRLLRKVR SIDLVELPNA DRCCGFGGTF       180
     AVKNGDVSAE MLAEKMRDVE NTGAEVCAAV DNSCLMHIYG GLHQRKVGIR TVHLAEILAS       240
     TEEETVR                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page