(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIC5_1.PE5

ACIC5_1.PE5          Location/Qualifiers
FT   CDS             complement(3710..4477)
FT                   /locus_tag="ACP_0005"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="GI:225871704"
FT                   /db_xref="GeneID:7698553"
FT                   /translation="MHLSLAARVLWAAGFTEQAALLLVLLLRKRFRAFPIFTIWIAFLV
FT                   LKNVVLFAVLGSLREYYYTYWLAEIIDLLLQIGVIYEICRNVLRPTGTWVRSALRSFLV
FT                   FGVAGIVLAAGLAWLAHPAESSFLGTWIERGRLFSSLITLELFVAMGFSSTRLGLVWRN
FT                   HVMAITTGWALWAAIGFAEELASAYHGPDYHGIVLDQIRIFSTQAVTVYWVAMFWLNEP
FT                   AERKLSPDMQIYLSNMQRRLESDAEILSNLRKP"
FT                   /protein_id="YP_002753158.1"
     MHLSLAARVL WAAGFTEQAA LLLVLLLRKR FRAFPIFTIW IAFLVLKNVV LFAVLGSLRE        60
     YYYTYWLAEI IDLLLQIGVI YEICRNVLRP TGTWVRSALR SFLVFGVAGI VLAAGLAWLA       120
     HPAESSFLGT WIERGRLFSS LITLELFVAM GFSSTRLGLV WRNHVMAITT GWALWAAIGF       180
     AEELASAYHG PDYHGIVLDQ IRIFSTQAVT VYWVAMFWLN EPAERKLSPD MQIYLSNMQR       240
     RLESDAEILS NLRKP                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page