(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIC5_1.PE9

ACIC5_1.PE9          Location/Qualifiers
FT   CDS             complement(5695..7197)
FT                   /locus_tag="ACP_0009"
FT                   /gene_family="HOG000260707" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Tat pathway signal sequence domain protein"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF06824;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="GI:225871708"
FT                   /db_xref="GeneID:7701013"
FT                   /translation="MVKRTTHPRITEMKNDSSSLAPTPITRRDLLRGGMAASALAAFPL
FT                   AQYKAATWKMDQGRPPVGERKFQSPAIEAAIQRVKALIADPVLGRMFERCFPNTLDTTV
FT                   FPGSVNGKPDTFVITGDIDAMWLRDSSAQVHPYLPFARQDAGLARLLEGVVRRQTRMIL
FT                   IDPYANAFMRSTTDPPLSWSLHDRTTMKPGVAERKWEIDSLCYTVRLAHGYWQATGDTS
FT                   PFDAEWRQAAQSILTTFKQQQRLQGQGPYSFGRLTTNPYDTLALNGYGNVARPVGMIYS
FT                   MFRPSDDSCVYPLFVPANLFAVRALEQLQELAAKAAGAPGIAEQCESLLETVRAALRQY
FT                   GTVQHPEHGRIWAYEVDGYGNTLCMDDANVPSLLSLPYLGCCDSNDPLYQNTRRFVLST
FT                   ANPWYFEGSAAQGIGSPHTGRNAIWPMSLLIRALTSTHDEEIVACLRWLRNTTGGTGYM
FT                   HESFDASDPSQYTRPWFAWANTLFGELVLKLAHEKPSLLQQA"
FT                   /protein_id="YP_002753162.1"
     MVKRTTHPRI TEMKNDSSSL APTPITRRDL LRGGMAASAL AAFPLAQYKA ATWKMDQGRP        60
     PVGERKFQSP AIEAAIQRVK ALIADPVLGR MFERCFPNTL DTTVFPGSVN GKPDTFVITG       120
     DIDAMWLRDS SAQVHPYLPF ARQDAGLARL LEGVVRRQTR MILIDPYANA FMRSTTDPPL       180
     SWSLHDRTTM KPGVAERKWE IDSLCYTVRL AHGYWQATGD TSPFDAEWRQ AAQSILTTFK       240
     QQQRLQGQGP YSFGRLTTNP YDTLALNGYG NVARPVGMIY SMFRPSDDSC VYPLFVPANL       300
     FAVRALEQLQ ELAAKAAGAP GIAEQCESLL ETVRAALRQY GTVQHPEHGR IWAYEVDGYG       360
     NTLCMDDANV PSLLSLPYLG CCDSNDPLYQ NTRRFVLSTA NPWYFEGSAA QGIGSPHTGR       420
     NAIWPMSLLI RALTSTHDEE IVACLRWLRN TTGGTGYMHE SFDASDPSQY TRPWFAWANT       480
     LFGELVLKLA HEKPSLLQQA                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page