(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE10

ACIDO1_5.PE10        Location/Qualifiers
FT   CDS             9678..10295
FT                   /locus_tag="AciX9_0010"
FT                   /gene_family="HOG000167971" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01352"
FT                   /codon_start="1"
FT                   /product="TonB family protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: TonB family protein; KEGG: xcv:XCV1693
FT                   TonB-like protein"
FT                   /db_xref="GI:322433669"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="GeneID:10201983"
FT                   /translation="MFDDEKKLGSDKSLRTAAVSAVVHVLVIAGLVGVIHSSRVIAPYR
FT                   LPGTAKGTQLLTYFSPDGSASKAATPVVAKPKAVRKAVAEAKVTMPPQETAEAKVTVGS
FT                   SSTNGASGQGSGDISIALPQKFPWPRPALDSMGHGTKGDVVLDATIDEQGKIASLVVTQ
FT                   SVNATVDEAVLATVRAWVFTPAMKQGKPVASEQEFRFHYERG"
FT                   /protein_id="YP_004215881.1"
     MFDDEKKLGS DKSLRTAAVS AVVHVLVIAG LVGVIHSSRV IAPYRLPGTA KGTQLLTYFS        60
     PDGSASKAAT PVVAKPKAVR KAVAEAKVTM PPQETAEAKV TVGSSSTNGA SGQGSGDISI       120
     ALPQKFPWPR PALDSMGHGT KGDVVLDATI DEQGKIASLV VTQSVNATVD EAVLATVRAW       180
     VFTPAMKQGK PVASEQEFRF HYERG                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page