(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE11

ACIDO1_5.PE11        Location/Qualifiers
FT   CDS             10832..13429
FT                   /locus_tag="AciX9_0011"
FT                   /gene_family="HOG000100642" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /codon_start="1"
FT                   /product="TonB-dependent receptor"
FT                   /transl_table="11"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; Cna B domain protein; KEGG: sus:Acid_3639
FT                   TonB-dependent receptor"
FT                   /db_xref="GI:322433670"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="GeneID:10201984"
FT                   /translation="MDDKGGLLPKASLTVKNDAGGAAQTAITDAAGRFTLSGLVAGSYT
FT                   VQATAPGFNTITKNVRVTDGGTNEVSLSLSIGNLTDQVTVEANSQGSVAAALAPMDALL
FT                   EATSARTEITSAFIQNFTSPVADFGEAVEMAPGTFTTNGNGVGLGQSSTYFRGFPDGDY
FT                   DIDFDGIPFYDTNTPSHHSWAFFPSQFLGGIDFDRSPGTASTIGPTPFGGSIHLLSKQF
FT                   SPMQNVRGGFSYGSFNTKLFDGEYDSGNFGPAHKFNVNVDVHHLGSDGYQTFNHQTRNA
FT                   GDIQFQYRPSDKTTITGFSAVIWLDANTPNFAATRCQMYGAQAGYTCTGANAPFAGSGI
FT                   NFLLTNNSDPLLYLNNQYNYYHVPTDFEYVGVRSELGKGFTFSIKPYTYNYDNSEKYSN
FT                   AVPITDNAALVGTTYAPLNVKIANTCSTLVKSKYTCGVDKYNSYRKYGETSELTQVSHF
FT                   GIFRAGLWYEWANTNRHQYPADPLQNWLDAPLPNFAETFVTNSYQPFVEYQYHATPKLT
FT                   ITPGIKFAYYTIGTKQFADNGGKIGGLGSNNPAAFITNGGSYFSSLPSGDVNYRIRDNW
FT                   SMYGQVATGSIVPASGTFDFTQSATGTPVATLPKQQKNLTYQTGTVLKLKRVTFDFDYF
FT                   HIHFDSGYSSFTPIDTGEPVYYLQPPSVTQGIEGESNVYITHGLSLYLNASYNRAQYTG
FT                   NATVFCNTAAACLSSTPQLSIATPGGQRISNAPSDIETEGLTYQHRSWDAGAFNKRVGT
FT                   MSLDNSGFHNAGTIDPFTLTNVFLNYTIKSGTHFNQTKIRLSFNNIFDNHNITGDSFAT
FT                   KATPLLITANGNTYNNPFVSASPITPLSGADAVSILPGRSVMLSVTFGLSPKR"
FT                   /protein_id="YP_004215882.1"
     MDDKGGLLPK ASLTVKNDAG GAAQTAITDA AGRFTLSGLV AGSYTVQATA PGFNTITKNV        60
     RVTDGGTNEV SLSLSIGNLT DQVTVEANSQ GSVAAALAPM DALLEATSAR TEITSAFIQN       120
     FTSPVADFGE AVEMAPGTFT TNGNGVGLGQ SSTYFRGFPD GDYDIDFDGI PFYDTNTPSH       180
     HSWAFFPSQF LGGIDFDRSP GTASTIGPTP FGGSIHLLSK QFSPMQNVRG GFSYGSFNTK       240
     LFDGEYDSGN FGPAHKFNVN VDVHHLGSDG YQTFNHQTRN AGDIQFQYRP SDKTTITGFS       300
     AVIWLDANTP NFAATRCQMY GAQAGYTCTG ANAPFAGSGI NFLLTNNSDP LLYLNNQYNY       360
     YHVPTDFEYV GVRSELGKGF TFSIKPYTYN YDNSEKYSNA VPITDNAALV GTTYAPLNVK       420
     IANTCSTLVK SKYTCGVDKY NSYRKYGETS ELTQVSHFGI FRAGLWYEWA NTNRHQYPAD       480
     PLQNWLDAPL PNFAETFVTN SYQPFVEYQY HATPKLTITP GIKFAYYTIG TKQFADNGGK       540
     IGGLGSNNPA AFITNGGSYF SSLPSGDVNY RIRDNWSMYG QVATGSIVPA SGTFDFTQSA       600
     TGTPVATLPK QQKNLTYQTG TVLKLKRVTF DFDYFHIHFD SGYSSFTPID TGEPVYYLQP       660
     PSVTQGIEGE SNVYITHGLS LYLNASYNRA QYTGNATVFC NTAAACLSST PQLSIATPGG       720
     QRISNAPSDI ETEGLTYQHR SWDAGAFNKR VGTMSLDNSG FHNAGTIDPF TLTNVFLNYT       780
     IKSGTHFNQT KIRLSFNNIF DNHNITGDSF ATKATPLLIT ANGNTYNNPF VSASPITPLS       840
     GADAVSILPG RSVMLSVTFG LSPKR                                             865
//

If you have problems or comments...

PBIL Back to PBIL home page