(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE12

ACIDO1_5.PE12        Location/Qualifiers
FT   CDS             13504..14964
FT                   /locus_tag="AciX9_0012"
FT                   /gene_family="HOG000100345" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:ACP_2727"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_2727 hypothetical protein"
FT                   /db_xref="GI:322433671"
FT                   /db_xref="GeneID:10201985"
FT                   /translation="MFKRYVLGCLVMMLGVGSAGAQASAANAKVATVPVVMLSDLHFDP
FT                   FHDPVKVPLLVKAPLEEWDRILGGPDSAGQAAAFAAIQTQCKAKENPDSSYALLRSALL
FT                   AAKAQTPSVGFVMVSGDLLVHDLDCRYPASMKLEASAGDDQAVSAAFAEKTTVYVMKKV
FT                   EATFAAVPVYLALGNNDSRCNHNRLSLHDEYLKASAAAVVDGLRGVSAAEKTAAMGTYE
FT                   SAGYYAVTMPGVMSGTRLLVVDDIYMMPKYANCEADDQDQQGAQEQMVWLQKELEDART
FT                   KGMSVWLLGHLPPAVNPDSSLEKGDSFCTKGKVVRYQTTDDLATEMTAYADVLKLGVFG
FT                   HTHMDELHLLRGKDAGVPVKVVGSVSPVDGNVPSFTVGLVATASAKLMDYSVYEASNST
FT                   GVGTTWPKEYGFDETYHEPSFSAEPLSDLIGRLRADTSGKGEESRAYQTHFIKGSSGKK
FT                   LSGSWPGYVCGLDNATAKGFKACVCGAK"
FT                   /protein_id="YP_004215883.1"
     MFKRYVLGCL VMMLGVGSAG AQASAANAKV ATVPVVMLSD LHFDPFHDPV KVPLLVKAPL        60
     EEWDRILGGP DSAGQAAAFA AIQTQCKAKE NPDSSYALLR SALLAAKAQT PSVGFVMVSG       120
     DLLVHDLDCR YPASMKLEAS AGDDQAVSAA FAEKTTVYVM KKVEATFAAV PVYLALGNND       180
     SRCNHNRLSL HDEYLKASAA AVVDGLRGVS AAEKTAAMGT YESAGYYAVT MPGVMSGTRL       240
     LVVDDIYMMP KYANCEADDQ DQQGAQEQMV WLQKELEDAR TKGMSVWLLG HLPPAVNPDS       300
     SLEKGDSFCT KGKVVRYQTT DDLATEMTAY ADVLKLGVFG HTHMDELHLL RGKDAGVPVK       360
     VVGSVSPVDG NVPSFTVGLV ATASAKLMDY SVYEASNSTG VGTTWPKEYG FDETYHEPSF       420
     SAEPLSDLIG RLRADTSGKG EESRAYQTHF IKGSSGKKLS GSWPGYVCGL DNATAKGFKA       480
     CVCGAK                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page