(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE13

ACIDO1_5.PE13        Location/Qualifiers
FT   CDS             complement(14972..17518)
FT                   /locus_tag="AciX9_0013"
FT                   /gene_family="HOG000135096" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01713"
FT                   /codon_start="1"
FT                   /product="Smr protein/MutS2"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_2271 MutS2 family protein; PFAM: Smr
FT                   protein/MutS2; DNA mismatch repair protein MutS domain
FT                   protein; SMART: DNA mismatch repair protein MutS domain
FT                   protein; MutS III domain protein; Smr protein/MutS2"
FT                   /db_xref="GI:322433672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="GeneID:10201986"
FT                   /translation="MTQLLPQIPSPLLESSSLALEWPRLRALIAAKAISPLGRAWTLAL
FT                   EPSTDLTWIIAQQTRTSELRSFLTGGGSFDFHGLFDPEALLAKARIDGTALESLEILTL
FT                   LNLTERVAAWRSLLAAAESARRLGPSIRALSEPLSYHDLAPLLRTLRGKIEPDGSLSDD
FT                   ASPELKRIRRAMESQHRAIEASLRRAARALREEGSTQSDRDDLITVRGERFVIPIKAEF
FT                   KRKVPGVIHGSSSSGQTVYVEPLETIEQNNELVRLLDEEQSEIHRILVALTRALAAQAH
FT                   VLSIGTIILAEVESHFIRARFAQDLDCTAPTFTPGLSLKSARHPLLELRMRAENLGAPG
FT                   PDSRTWVGTTDTPERKPTKPIPLTLALTTEARQLIISGPNTGGKTVSLKTTGLLALMAQ
FT                   AGLLVPAEEATFPLFTAIFADIGDAQSIERNLSSFSAHVVNVDHISRHADGHSLVLLDE
FT                   LGSATDPEEGAALAVAVAEHFLNLNAWTAITTHLTSLKVYAAQHTGVLNAAVGFDQATL
FT                   TPTYELRLGVPGASAGLNIAARLGMAPTIIASARAQMTTQQADIGAFLDQLHDQISAAT
FT                   SERVSLKRRTEEVATERARLETEGRAEQKQRTRELELKLKTLLEDFETQLKETVNEIED
FT                   KTVARKIQRDSALRMARVRREFSDQFSSTVLAHTAGADKNDIASPLARRALTPIKAGDY
FT                   VTLKSLRRQATVVRVIDEHNFEVSMGQMKMRVPRTDIADVEVIKVVTPAEAARRRGNIT
FT                   VQTASGAPLGDSDYTPREINVIGRTAAEAEDEVSRYIDKAFLSGLERVRIVHGTGMGVL
FT                   RRTLREFLKSHPHVATFAEASQQEGGQGATLVDLRQ"
FT                   /protein_id="YP_004215884.1"
     MTQLLPQIPS PLLESSSLAL EWPRLRALIA AKAISPLGRA WTLALEPSTD LTWIIAQQTR        60
     TSELRSFLTG GGSFDFHGLF DPEALLAKAR IDGTALESLE ILTLLNLTER VAAWRSLLAA       120
     AESARRLGPS IRALSEPLSY HDLAPLLRTL RGKIEPDGSL SDDASPELKR IRRAMESQHR       180
     AIEASLRRAA RALREEGSTQ SDRDDLITVR GERFVIPIKA EFKRKVPGVI HGSSSSGQTV       240
     YVEPLETIEQ NNELVRLLDE EQSEIHRILV ALTRALAAQA HVLSIGTIIL AEVESHFIRA       300
     RFAQDLDCTA PTFTPGLSLK SARHPLLELR MRAENLGAPG PDSRTWVGTT DTPERKPTKP       360
     IPLTLALTTE ARQLIISGPN TGGKTVSLKT TGLLALMAQA GLLVPAEEAT FPLFTAIFAD       420
     IGDAQSIERN LSSFSAHVVN VDHISRHADG HSLVLLDELG SATDPEEGAA LAVAVAEHFL       480
     NLNAWTAITT HLTSLKVYAA QHTGVLNAAV GFDQATLTPT YELRLGVPGA SAGLNIAARL       540
     GMAPTIIASA RAQMTTQQAD IGAFLDQLHD QISAATSERV SLKRRTEEVA TERARLETEG       600
     RAEQKQRTRE LELKLKTLLE DFETQLKETV NEIEDKTVAR KIQRDSALRM ARVRREFSDQ       660
     FSSTVLAHTA GADKNDIASP LARRALTPIK AGDYVTLKSL RRQATVVRVI DEHNFEVSMG       720
     QMKMRVPRTD IADVEVIKVV TPAEAARRRG NITVQTASGA PLGDSDYTPR EINVIGRTAA       780
     EAEDEVSRYI DKAFLSGLER VRIVHGTGMG VLRRTLREFL KSHPHVATFA EASQQEGGQG       840
     ATLVDLRQ                                                                848
//

If you have problems or comments...

PBIL Back to PBIL home page