(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE14

ACIDO1_5.PE14        Location/Qualifiers
FT   CDS             17585..19639
FT                   /locus_tag="AciX9_0014"
FT                   /gene_family="HOG000245572" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.4.24.71"
FT                   /codon_start="1"
FT                   /EC_number="3.4.24.71"
FT                   /transl_table="11"
FT                   /note="KEGG: aba:Acid345_1491 PgPepO oligopeptidase; PFAM:
FT                   peptidase M13; Peptidase M13, neprilysin-like"
FT                   /db_xref="GI:322433673"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="GeneID:10201987"
FT                   /translation="MKLKMAAAVLSLLGGVGAGAQGTVLPVVQPLSAIPFSPVLDLTSL
FT                   DKTVDPCVDFYKFSCGGWMKKNPIPADQASWSVYHKLAIDNQQFLWGILKDDAVAKDRT
FT                   PVQQKVGDYYAACMNTPAIDALGMKPVEAGLARLDMITTREQAAHAIATLHHNVAGSFF
FT                   FGSGVGQDAVDSSTEIVEVGAGGLGLPDRDYYLKTDAKSVKLREQYVAYVQQLMTLAGE
FT                   PSEKASADAKAILTIETALATGSLTVVERRDPHKIYHMMTLAELGGLAPGIDWAGYFKT
FT                   QGAGAFTKLNVSQPEFMKAVQAELMTEPVEALKAYLKFHMLTAAAPYLSHPFVQANFDF
FT                   YSKTLRGVPTMPARWKTCTGGVDRMLGEALGQEFVRRTFSSEMKAKTRTMTEQIEAAMK
FT                   GEIEGLDWMSPETKVEAERKLHAIRNKIGYPDTWRDYSTLEVKPDDYAGDAVRAYRFED
FT                   ARNWNKLGKPVDLTEWGMTPPTVNAYFNPQMNDINFPAGVLQPPLYDAKEDDAPNYGNT
FT                   GATIGHELTHAFDDEGRQFDDKGNLRDWWTAADAKGFEQRIQCVRDQYAGYVVVDDIHI
FT                   NSKLTSGEDVADLGGTLLAYIAWKKETAGQKLMPINGFTPDQRFFVGMAQWACENERPE
FT                   NLRVSAATDPHSPGFARINGVVSNMPEFKNAFQCKAGQAMVHVPACRVW"
FT                   /product="Endothelin-converting enzyme 1"
FT                   /protein_id="YP_004215885.1"
     MKLKMAAAVL SLLGGVGAGA QGTVLPVVQP LSAIPFSPVL DLTSLDKTVD PCVDFYKFSC        60
     GGWMKKNPIP ADQASWSVYH KLAIDNQQFL WGILKDDAVA KDRTPVQQKV GDYYAACMNT       120
     PAIDALGMKP VEAGLARLDM ITTREQAAHA IATLHHNVAG SFFFGSGVGQ DAVDSSTEIV       180
     EVGAGGLGLP DRDYYLKTDA KSVKLREQYV AYVQQLMTLA GEPSEKASAD AKAILTIETA       240
     LATGSLTVVE RRDPHKIYHM MTLAELGGLA PGIDWAGYFK TQGAGAFTKL NVSQPEFMKA       300
     VQAELMTEPV EALKAYLKFH MLTAAAPYLS HPFVQANFDF YSKTLRGVPT MPARWKTCTG       360
     GVDRMLGEAL GQEFVRRTFS SEMKAKTRTM TEQIEAAMKG EIEGLDWMSP ETKVEAERKL       420
     HAIRNKIGYP DTWRDYSTLE VKPDDYAGDA VRAYRFEDAR NWNKLGKPVD LTEWGMTPPT       480
     VNAYFNPQMN DINFPAGVLQ PPLYDAKEDD APNYGNTGAT IGHELTHAFD DEGRQFDDKG       540
     NLRDWWTAAD AKGFEQRIQC VRDQYAGYVV VDDIHINSKL TSGEDVADLG GTLLAYIAWK       600
     KETAGQKLMP INGFTPDQRF FVGMAQWACE NERPENLRVS AATDPHSPGF ARINGVVSNM       660
     PEFKNAFQCK AGQAMVHVPA CRVW                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page