(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE15

ACIDO1_5.PE15        Location/Qualifiers
FT   CDS             20202..20543
FT                   /locus_tag="AciX9_0015"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Acid_7413"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_7413 hypothetical protein"
FT                   /db_xref="GI:322433674"
FT                   /db_xref="GeneID:10201988"
FT                   /translation="MVAGIAAYFAVHALARHGWWGDGSDFMPEVFQCLLPFIAFGTTVM
FT                   AGLSVLTGYGLLTRRSWGRPLAIIMAILSLIKIPLGTALGIYTLWVLGSKAGGAEYEGL
FT                   AAAEEGIRV"
FT                   /protein_id="YP_004215886.1"
     MVAGIAAYFA VHALARHGWW GDGSDFMPEV FQCLLPFIAF GTTVMAGLSV LTGYGLLTRR        60
     SWGRPLAIIM AILSLIKIPL GTALGIYTLW VLGSKAGGAE YEGLAAAEEG IRV              113
//

If you have problems or comments...

PBIL Back to PBIL home page