(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE16

ACIDO1_5.PE16        Location/Qualifiers
FT   CDS             complement(20660..21346)
FT                   /locus_tag="AciX9_0016"
FT                   /gene_family="HOG000275099" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Acid_1798"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_1798 hypothetical protein"
FT                   /db_xref="GI:322433675"
FT                   /db_xref="GeneID:10201989"
FT                   /translation="MKVMLFGGTGMVGQGALRECLLDPSIKEVVAITRSTVAQPIPTPS
FT                   PKLRQIIRKDLFDLDGLDDEFAAVDTCMFCLGVTSFRMKEDDYRHITYDLTLSVAKRFV
FT                   RVNPKVVFIYVSGAGTDSTGESKTMWARVKGETENDLLALPLRAAFMFRPGGIVPQHGI
FT                   KSKTAVYQVFYSILKPIMPLFERFFPKYVTTTDQLGGAMLRLAKKGVAQEGPPRRVLES
FT                   VDIARM"
FT                   /protein_id="YP_004215887.1"
     MKVMLFGGTG MVGQGALREC LLDPSIKEVV AITRSTVAQP IPTPSPKLRQ IIRKDLFDLD        60
     GLDDEFAAVD TCMFCLGVTS FRMKEDDYRH ITYDLTLSVA KRFVRVNPKV VFIYVSGAGT       120
     DSTGESKTMW ARVKGETEND LLALPLRAAF MFRPGGIVPQ HGIKSKTAVY QVFYSILKPI       180
     MPLFERFFPK YVTTTDQLGG AMLRLAKKGV AQEGPPRRVL ESVDIARM                    228
//

If you have problems or comments...

PBIL Back to PBIL home page