(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE17

ACIDO1_5.PE17        Location/Qualifiers
FT   CDS             21464..22453
FT                   /locus_tag="AciX9_0017"
FT                   /gene_family="HOG000020323" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.2.1.24"
FT                   /codon_start="1"
FT                   /EC_number="4.2.1.24"
FT                   /transl_table="11"
FT                   /note="manually curated; KEGG: aca:ACP_2188
FT                   delta-aminolevulinic acid dehydratase; PFAM:
FT                   delta-aminolevulinic acid dehydratase"
FT                   /db_xref="GI:322433676"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="GeneID:10201990"
FT                   /translation="MTGHVTRMRRMRRTEALRSLVRETHLRPESLIYPLFIVPGEGVRK
FT                   PISSMPGVFNVSVDEALKDAAECVELGLGGLLLFGLPPEKDEQGSGAWDEQGIMQTALR
FT                   AIKRESGLKSLVTIADVCLCEYTSHGHCGIVARDGEEYAVENDSSVRLIAKTAASLAEA
FT                   GADIVAPSDMMDGRVEAIRAALDEGGHQQTPIMSYAAKFASAFYGPFREAADSAPQFGD
FT                   RKTYQMDGANRREAMREIEQDLLEGADMILMKPAMPYLDVLKEARDRYEVPIGAYQVSG
FT                   EYSMLVAAFERGWLERERAIIESLLSLRRAGADFIVTYFAKEAGRALG"
FT                   /product="Porphobilinogen synthase"
FT                   /protein_id="YP_004215888.1"
     MTGHVTRMRR MRRTEALRSL VRETHLRPES LIYPLFIVPG EGVRKPISSM PGVFNVSVDE        60
     ALKDAAECVE LGLGGLLLFG LPPEKDEQGS GAWDEQGIMQ TALRAIKRES GLKSLVTIAD       120
     VCLCEYTSHG HCGIVARDGE EYAVENDSSV RLIAKTAASL AEAGADIVAP SDMMDGRVEA       180
     IRAALDEGGH QQTPIMSYAA KFASAFYGPF REAADSAPQF GDRKTYQMDG ANRREAMREI       240
     EQDLLEGADM ILMKPAMPYL DVLKEARDRY EVPIGAYQVS GEYSMLVAAF ERGWLERERA       300
     IIESLLSLRR AGADFIVTYF AKEAGRALG                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page