(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE18

ACIDO1_5.PE18        Location/Qualifiers
FT   CDS             22559..22900
FT                   /locus_tag="AciX9_0018"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BMD_0418"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bmd:BMD_0418 hypothetical protein"
FT                   /db_xref="GI:322433677"
FT                   /db_xref="GeneID:10201991"
FT                   /translation="MRRNLALILLFGWVPVALGVFLLSEFWLQQPFLTLGVIIGWFVAA
FT                   CGMIWWAGEFRCPRCRRRYGAVGSRKGVNLIWRGLFDSICNNCKLRKFENFNSEGSNPG
FT                   SLDRRMARD"
FT                   /protein_id="YP_004215889.1"
     MRRNLALILL FGWVPVALGV FLLSEFWLQQ PFLTLGVIIG WFVAACGMIW WAGEFRCPRC        60
     RRRYGAVGSR KGVNLIWRGL FDSICNNCKL RKFENFNSEG SNPGSLDRRM ARD              113
//

If you have problems or comments...

PBIL Back to PBIL home page