(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE2

ACIDO1_5.PE2         Location/Qualifiers
FT   CDS             1619..2437
FT                   /locus_tag="AciX9_0002"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:ACP_1959"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_1959 hypothetical protein"
FT                   /db_xref="GI:322433661"
FT                   /db_xref="GeneID:10201975"
FT                   /translation="MRRLLFVGTVAALMPLCGGVAGAQALPGVAELRARALESYQKSSA
FT                   ARERYICKELIRNDELNGNGEVKKSYLDEREIFYVNGFQISQEVSKNGRALNEGEIRKR
FT                   DENVRKQIEAASDHKRPKTQGLVISAGDVLRLAKLDHERRVMVAGRPTIVFDVVPDDDA
FT                   KASTVEEKLVAAMAGTVSIDEATGNLQDVNTTGAKDVKVGGGLVANVHKGFAMHILVAP
FT                   EPDGVWLLKLAEGTGEARIGLVTKSAMRFHQETEGCKLYDVDATQVDKKK"
FT                   /protein_id="YP_004215873.1"
     MRRLLFVGTV AALMPLCGGV AGAQALPGVA ELRARALESY QKSSAARERY ICKELIRNDE        60
     LNGNGEVKKS YLDEREIFYV NGFQISQEVS KNGRALNEGE IRKRDENVRK QIEAASDHKR       120
     PKTQGLVISA GDVLRLAKLD HERRVMVAGR PTIVFDVVPD DDAKASTVEE KLVAAMAGTV       180
     SIDEATGNLQ DVNTTGAKDV KVGGGLVANV HKGFAMHILV APEPDGVWLL KLAEGTGEAR       240
     IGLVTKSAMR FHQETEGCKL YDVDATQVDK KK                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page