(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE20

ACIDO1_5.PE20        Location/Qualifiers
FT   CDS             23534..25003
FT                   /locus_tag="AciX9_0020"
FT                   /gene_family="HOG000276708" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01350"
FT                   /codon_start="1"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_2857 dihydrolipoyl dehydrogenase;
FT                   TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region"
FT                   /db_xref="GI:322433679"
FT                   /db_xref="GO:0004148"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:10201993"
FT                   /translation="MSDTIFDLVVVGGGPAGYTCGIRAAQLGLKVALIEKTDKLGGTCL
FT                   HWGCIPTKSLLFSAEIWDHLKHAANYGIDNVDAPKLNWDNLIKRKSDITNKHTKGLDFL
FT                   MKKNKITVFRGHGRLTGPAKDGIHTITVTDEDKASGRGKDAQAEGYTSQKVDEIKAKKV
FT                   VLSTGSDARMLPGYKADDTILTNMEILTLPAMPKSMVVIGSGAVGVEFASIFKSFGAEV
FT                   TIIEALPRLVNAEDEEISKELLRLYKKRGFEVFLSAKVEKIDKKDGGAVVTFTDSTGKQ
FT                   QTKTAEKVLVAVGRAPRTYDCGLDKVNIPLDRGFIMTNEWMETTEPGIYAIGDIVGGLP
FT                   QLAHVGAMCGVVVASKLAGKYARPVNRQRIPGCTYCDPQIGSVGLTEAQAKEKGYQVKV
FT                   GKFPFVGNSKATILDSHDGFVKVVSDAKYGEVLGVHIIGPQATEIIAECVTALELEATV
FT                   EEMMFTIHAHPTLSESLLDGFSSVEGMAINV"
FT                   /protein_id="YP_004215891.1"
     MSDTIFDLVV VGGGPAGYTC GIRAAQLGLK VALIEKTDKL GGTCLHWGCI PTKSLLFSAE        60
     IWDHLKHAAN YGIDNVDAPK LNWDNLIKRK SDITNKHTKG LDFLMKKNKI TVFRGHGRLT       120
     GPAKDGIHTI TVTDEDKASG RGKDAQAEGY TSQKVDEIKA KKVVLSTGSD ARMLPGYKAD       180
     DTILTNMEIL TLPAMPKSMV VIGSGAVGVE FASIFKSFGA EVTIIEALPR LVNAEDEEIS       240
     KELLRLYKKR GFEVFLSAKV EKIDKKDGGA VVTFTDSTGK QQTKTAEKVL VAVGRAPRTY       300
     DCGLDKVNIP LDRGFIMTNE WMETTEPGIY AIGDIVGGLP QLAHVGAMCG VVVASKLAGK       360
     YARPVNRQRI PGCTYCDPQI GSVGLTEAQA KEKGYQVKVG KFPFVGNSKA TILDSHDGFV       420
     KVVSDAKYGE VLGVHIIGPQ ATEIIAECVT ALELEATVEE MMFTIHAHPT LSESLLDGFS       480
     SVEGMAINV                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page