(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE21

ACIDO1_5.PE21        Location/Qualifiers
FT   CDS             complement(25075..25440)
FT                   /locus_tag="AciX9_0021"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Cyan7425_3930"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cyn:Cyan7425_3930 protein of unknown function
FT                   DUF1400"
FT                   /db_xref="GI:322433680"
FT                   /db_xref="GeneID:10201994"
FT                   /translation="MTIQPPIPPAQTVAIPLTPEVRAAYQALYDANEALIENTTDPGFL
FT                   AALNDVSTNVGNILTKDNLYRIEANNALFQALQQQINSTNASLLALKKQIQAVASHVSE
FT                   AGTVLSAIDKVVSLATG"
FT                   /protein_id="YP_004215892.1"
     MTIQPPIPPA QTVAIPLTPE VRAAYQALYD ANEALIENTT DPGFLAALND VSTNVGNILT        60
     KDNLYRIEAN NALFQALQQQ INSTNASLLA LKKQIQAVAS HVSEAGTVLS AIDKVVSLAT       120
     G                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page