(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE25

ACIDO1_5.PE25        Location/Qualifiers
FT   CDS             complement(29199..30083)
FT                   /locus_tag="AciX9_0025"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Fjoh_3583"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: fjo:Fjoh_3583 hypothetical protein"
FT                   /db_xref="GI:322433684"
FT                   /db_xref="GeneID:10201998"
FT                   /translation="MLAIGFTLLLGAYLFGPGLIARLILGFAVPRKTLVQSRSEEVTRS
FT                   IVQAVVPFGIALVWARATGALQQSGHLTDLQTVFSGIYSTSFFDAHRQDFFSSLHAFCQ
FT                   MNLCLLLRLYLLVVLFALTLNLAIRNYSQLRARLPLGWQKALLATLVLPRVSEWHVLLS
FT                   EMLLPAGDFLDADVLTKSSVLYQGRIQDKMLGADGSLQSITLAKPRRFLRDEFEKAKEA
FT                   DPNVDREAYWRSIAGNLFVLMASDVINLNLKYIHRNPIDFRSSQEERIVLRRLLERLSN
FT                   DETDRDQTDRQAD"
FT                   /protein_id="YP_004215896.1"
     MLAIGFTLLL GAYLFGPGLI ARLILGFAVP RKTLVQSRSE EVTRSIVQAV VPFGIALVWA        60
     RATGALQQSG HLTDLQTVFS GIYSTSFFDA HRQDFFSSLH AFCQMNLCLL LRLYLLVVLF       120
     ALTLNLAIRN YSQLRARLPL GWQKALLATL VLPRVSEWHV LLSEMLLPAG DFLDADVLTK       180
     SSVLYQGRIQ DKMLGADGSL QSITLAKPRR FLRDEFEKAK EADPNVDREA YWRSIAGNLF       240
     VLMASDVINL NLKYIHRNPI DFRSSQEERI VLRRLLERLS NDETDRDQTD RQAD             294
//

If you have problems or comments...

PBIL Back to PBIL home page