(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE26

ACIDO1_5.PE26        Location/Qualifiers
FT   CDS             complement(30084..30296)
FT                   /locus_tag="AciX9_0026"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:MYPU_6250"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mpu:MYPU_6250 ABC transporter
FT                   permease/ATP-binding protein"
FT                   /db_xref="GI:322433685"
FT                   /db_xref="GeneID:10201999"
FT                   /translation="MNGREIERLLTMIDANIAANQTILKDEMLRFIESHEDQVVNELRA
FT                   HESADIPTSAGVMTIKLSDLRELVA"
FT                   /protein_id="YP_004215897.1"
     MNGREIERLL TMIDANIAAN QTILKDEMLR FIESHEDQVV NELRAHESAD IPTSAGVMTI        60
     KLSDLRELVA                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page