(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE27

ACIDO1_5.PE27        Location/Qualifiers
FT   CDS             complement(30435..31601)
FT                   /locus_tag="AciX9_0027"
FT                   /gene_family="HOG000034029" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01161"
FT                   /codon_start="1"
FT                   /EC_number="4.1.1.21"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   ATPase subunit; KEGG: aca:ACP_2355
FT                   phosphoribosylaminoimidazole carboxylase, ATPase subunit;
FT                   PFAM: ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp"
FT                   /db_xref="GI:322433686"
FT                   /db_xref="GO:0004638"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="GeneID:10202000"
FT                   /translation="MKAGTPLLPGATIGIFGGGQLGRMMAMAARGMGYRILVLDPDPGC
FT                   PARFIVDGCIEAGWDDSRGAAMLARGCDVVTLEIEQIGERSMASAATFCPVRPGGAMLA
FT                   IIQDRIEQKNWLTKHGFPVGEFRAVRSLDETRAAIAELGRCFCKSATGGYDGRGQGKVG
FT                   FSAEPVTEADVLGAWEALGEGPGVVEKAVHLEREISVMVARSPRGEVKVYPAAWNHHEN
FT                   QILDWSVIPAPIPPSMEAEAREIAYEIADTFQLEGLLAVEMFITQDGELLINELAPRPH
FT                   NSYHESERACVTSQFEQAIRAVCDLPLGDVEVVQPAAIANLLGDLWLNPDGSAREVCFD
FT                   KALAVPGVALHLYEKLKPRKGRKMGHLSAIGATAEQAIERVLRAKAAL"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /protein_id="YP_004215898.1"
     MKAGTPLLPG ATIGIFGGGQ LGRMMAMAAR GMGYRILVLD PDPGCPARFI VDGCIEAGWD        60
     DSRGAAMLAR GCDVVTLEIE QIGERSMASA ATFCPVRPGG AMLAIIQDRI EQKNWLTKHG       120
     FPVGEFRAVR SLDETRAAIA ELGRCFCKSA TGGYDGRGQG KVGFSAEPVT EADVLGAWEA       180
     LGEGPGVVEK AVHLEREISV MVARSPRGEV KVYPAAWNHH ENQILDWSVI PAPIPPSMEA       240
     EAREIAYEIA DTFQLEGLLA VEMFITQDGE LLINELAPRP HNSYHESERA CVTSQFEQAI       300
     RAVCDLPLGD VEVVQPAAIA NLLGDLWLNP DGSAREVCFD KALAVPGVAL HLYEKLKPRK       360
     GRKMGHLSAI GATAEQAIER VLRAKAAL                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page