(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE28

ACIDO1_5.PE28        Location/Qualifiers
FT   CDS             complement(31607..32104)
FT                   /locus_tag="AciX9_0028"
FT                   /gene_family="HOG000034141" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01162"
FT                   /codon_start="1"
FT                   /EC_number="4.1.1.21"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit; KEGG: aca:ACP_2356
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="GI:322433687"
FT                   /db_xref="GO:0004638"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="GeneID:10202001"
FT                   /translation="MPLVGVVMGSRSDYAVMKAAVDVLREFGVPYEAKVVSAHRTPELM
FT                   VEYAQTAIARGLRVIIAGAGGAAHLPGMIAALTVVPVLGVPVSATSLQGLDALLSIVQM
FT                   PKGVPVGTLAIGASGAANAGLLAVAMLATTDAELQQKLIARREATRDKVLGESLEEDEV
FT                   KA"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /protein_id="YP_004215899.1"
     MPLVGVVMGS RSDYAVMKAA VDVLREFGVP YEAKVVSAHR TPELMVEYAQ TAIARGLRVI        60
     IAGAGGAAHL PGMIAALTVV PVLGVPVSAT SLQGLDALLS IVQMPKGVPV GTLAIGASGA       120
     ANAGLLAVAM LATTDAELQQ KLIARREATR DKVLGESLEE DEVKA                       165
//

If you have problems or comments...

PBIL Back to PBIL home page