(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE29

ACIDO1_5.PE29        Location/Qualifiers
FT   CDS             complement(32158..32415)
FT                   /locus_tag="AciX9_0029"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Acid345_4353"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aba:Acid345_4353 hypothetical protein"
FT                   /db_xref="GI:322433688"
FT                   /db_xref="GeneID:10202002"
FT                   /translation="MAFESGVHRAAGVRRAMAKGPALEMRAMAVEFPEVLGQPGRLHHL
FT                   EQRVSRNEQGVQRMRGITAAFGTALTMMHFAISYFTGKHH"
FT                   /protein_id="YP_004215900.1"
     MAFESGVHRA AGVRRAMAKG PALEMRAMAV EFPEVLGQPG RLHHLEQRVS RNEQGVQRMR        60
     GITAAFGTAL TMMHFAISYF TGKHH                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page