(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE3

ACIDO1_5.PE3         Location/Qualifiers
FT   CDS             3078..4271
FT                   /locus_tag="AciX9_0003"
FT                   /gene_family="HOG000071791" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: aca:ACP_2196 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="GI:322433662"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0008408"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="GeneID:10201976"
FT                   /translation="MPTLTEDSETNTNVAAPTGNLEITVSRAELLRELTAAQSVVERKT
FT                   TIPILSNFLFEASNEGETGRLTITATDLDQSLRTSCAAKVKKAGACTIPARKLYDYIRL
FT                   LPEGEISIKLMDNHWVQIRAGRSNTKMVGMARANFPQVAEFPASGAYTLSVASLKTMVS
FT                   KTIFAISNEESRYTLNGALLVLKAESMAMVATDGHRLAHVEKLGETLEGISGEKKTLIP
FT                   RKALSELSSLLNSTDAETMQFADDDSTLFFKMGGRVLTSRKLTGQFPNYEAVLPRDNNK
FT                   FVIVRSEDLMSAIQRVAQFADERSGAIKIRLEQNELRLSSSSTDSGESEDTIETPYNYD
FT                   PLVVGFNSQYLIDFLKAIGNTGEVRLEFKDAQSAGQMRPEDGNEDVKYRYILMPMRI"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /protein_id="YP_004215874.1"
     MPTLTEDSET NTNVAAPTGN LEITVSRAEL LRELTAAQSV VERKTTIPIL SNFLFEASNE        60
     GETGRLTITA TDLDQSLRTS CAAKVKKAGA CTIPARKLYD YIRLLPEGEI SIKLMDNHWV       120
     QIRAGRSNTK MVGMARANFP QVAEFPASGA YTLSVASLKT MVSKTIFAIS NEESRYTLNG       180
     ALLVLKAESM AMVATDGHRL AHVEKLGETL EGISGEKKTL IPRKALSELS SLLNSTDAET       240
     MQFADDDSTL FFKMGGRVLT SRKLTGQFPN YEAVLPRDNN KFVIVRSEDL MSAIQRVAQF       300
     ADERSGAIKI RLEQNELRLS SSSTDSGESE DTIETPYNYD PLVVGFNSQY LIDFLKAIGN       360
     TGEVRLEFKD AQSAGQMRPE DGNEDVKYRY ILMPMRI                                397
//

If you have problems or comments...

PBIL Back to PBIL home page