(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE30

ACIDO1_5.PE30        Location/Qualifiers
FT   CDS             complement(32604..32939)
FT                   /locus_tag="AciX9_0030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Paes_0284"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: paa:Paes_0284 50S ribosomal protein L11"
FT                   /db_xref="GI:322433689"
FT                   /db_xref="GeneID:10202003"
FT                   /translation="MAGRFVKGTTDEPEESTSLGRKGVRNPRFFKTFARKQFAEALPVI
FT                   VSVLLDKAKSGSVSHLKLLVELSGLEKDPDPKKMKPRGKSLEAILTEQWAKDKAEAALK
FT                   PATGGWR"
FT                   /protein_id="YP_004215901.1"
     MAGRFVKGTT DEPEESTSLG RKGVRNPRFF KTFARKQFAE ALPVIVSVLL DKAKSGSVSH        60
     LKLLVELSGL EKDPDPKKMK PRGKSLEAIL TEQWAKDKAE AALKPATGGW R                111
//

If you have problems or comments...

PBIL Back to PBIL home page