(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE31

ACIDO1_5.PE31        Location/Qualifiers
FT   CDS             complement(33207..33788)
FT                   /locus_tag="AciX9_0031"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:ACP_2372"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_2372 hypothetical protein"
FT                   /db_xref="GI:322433690"
FT                   /db_xref="GeneID:10202004"
FT                   /translation="MSAALVILPVIQAMAEVASRPAAGPISATGAALRKGPHRLTLVRA
FT                   SAAVLPDAEERIRLRPSPELSFYRKYTEAMLKRYTKLSMEAGRAPSLLGRELFRGHVTN
FT                   YKVSSFDDVVIYVHDVENCVAKLGRGQQYLVRKIAMQGYTQQETAAMIGTNLKIVIKRY
FT                   VEAIDLLTRLFLDLGLLAPTVASKRVTEGQ"
FT                   /protein_id="YP_004215902.1"
     MSAALVILPV IQAMAEVASR PAAGPISATG AALRKGPHRL TLVRASAAVL PDAEERIRLR        60
     PSPELSFYRK YTEAMLKRYT KLSMEAGRAP SLLGRELFRG HVTNYKVSSF DDVVIYVHDV       120
     ENCVAKLGRG QQYLVRKIAM QGYTQQETAA MIGTNLKIVI KRYVEAIDLL TRLFLDLGLL       180
     APTVASKRVT EGQ                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page