(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE32

ACIDO1_5.PE32        Location/Qualifiers
FT   CDS             34487..35683
FT                   /locus_tag="AciX9_0032"
FT                   /gene_family="HOG000100685" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:ACP_2051"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_2051 hypothetical protein"
FT                   /db_xref="GI:322433691"
FT                   /db_xref="GeneID:10202005"
FT                   /translation="MFSRLYAKWMFAWETALTTRDTNRIVRPVEWGFDWLPPLTTPMPG
FT                   ASDEAQMTALSAQIAAQSDEFFAYATPSDFRLEERHPQLFPTNVRPETLAQDADLKRKA
FT                   SSGKLKAASFLRFTSAASTPYPENDQVNARWYPASPEQEEKFRRLGKPRQAMIVMPQWN
FT                   ADAFSHNALCEIFNRFGISCLRLSKPYHDIRRPAELERSDYAVSANIGRTMAACRQAVV
FT                   DIRSCIDWLSQQGYEQFGVLGTSLGSCYAFIAAAHDARLNVCAFNHASTWFGDVVWTGQ
FT                   STRHVREALEQAGLTQITTREVFRAVSPMAYMDRFAANPKRVLVVHAKYDLTFLEEFSL
FT                   DVLKNFNEYGIDYVSRVLPCGHYTTGETPYKYIDAWYLGSFIHDAFKKLAFENLKPVS"
FT                   /protein_id="YP_004215903.1"
     MFSRLYAKWM FAWETALTTR DTNRIVRPVE WGFDWLPPLT TPMPGASDEA QMTALSAQIA        60
     AQSDEFFAYA TPSDFRLEER HPQLFPTNVR PETLAQDADL KRKASSGKLK AASFLRFTSA       120
     ASTPYPENDQ VNARWYPASP EQEEKFRRLG KPRQAMIVMP QWNADAFSHN ALCEIFNRFG       180
     ISCLRLSKPY HDIRRPAELE RSDYAVSANI GRTMAACRQA VVDIRSCIDW LSQQGYEQFG       240
     VLGTSLGSCY AFIAAAHDAR LNVCAFNHAS TWFGDVVWTG QSTRHVREAL EQAGLTQITT       300
     REVFRAVSPM AYMDRFAANP KRVLVVHAKY DLTFLEEFSL DVLKNFNEYG IDYVSRVLPC       360
     GHYTTGETPY KYIDAWYLGS FIHDAFKKLA FENLKPVS                               398
//

If you have problems or comments...

PBIL Back to PBIL home page