(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE33

ACIDO1_5.PE33        Location/Qualifiers
FT   CDS             36049..37317
FT                   /locus_tag="AciX9_0033"
FT                   /gene_family="HOG000239403" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.1.2.1"
FT                   /codon_start="1"
FT                   /EC_number="2.1.2.1"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_2846 serine hydroxymethyltransferase;
FT                   PFAM: glycine hydroxymethyltransferase"
FT                   /db_xref="GI:322433692"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="GeneID:10202006"
FT                   /translation="MPIDLNATLSAADPEIAAQIENEVNRQHEGLEMIASENFVSRAVL
FT                   EAAGTVFTNKYAEGYPGKRYYGGCEFADVVEDLARSRAKKLFGAEHVNVQPHSGSQANA
FT                   ATCMTLLTPGDTILGLDLAHGGHLTHGHKLNFSGKLYKIAGYQVSKDTETVDYDELEAQ
FT                   AERERPKMIIGGGSAYPRQFDFPRLRAIADKVGAYLMVDMAHFAGLVAGGAHPSPIPHA
FT                   HVVTTTTHKTLRGPRAGMILCGQEFAAGIDRSVFPGQQGGPLMHIIAAKAVAFKEALQP
FT                   EFAQYATQTVTNAKVLAEAIAEKGFRIVSGGTDTHLMLVDVFQKGMLGSEAEHALGEAG
FT                   ITVNKNAIPYDTNPPMKPSGIRIGTPALTTRGMKEAEMLVIAGWIVRALEQRSDPAALA
FT                   KIRGEVLELAEQFPLYEYLRAQA"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /protein_id="YP_004215904.1"
     MPIDLNATLS AADPEIAAQI ENEVNRQHEG LEMIASENFV SRAVLEAAGT VFTNKYAEGY        60
     PGKRYYGGCE FADVVEDLAR SRAKKLFGAE HVNVQPHSGS QANAATCMTL LTPGDTILGL       120
     DLAHGGHLTH GHKLNFSGKL YKIAGYQVSK DTETVDYDEL EAQAERERPK MIIGGGSAYP       180
     RQFDFPRLRA IADKVGAYLM VDMAHFAGLV AGGAHPSPIP HAHVVTTTTH KTLRGPRAGM       240
     ILCGQEFAAG IDRSVFPGQQ GGPLMHIIAA KAVAFKEALQ PEFAQYATQT VTNAKVLAEA       300
     IAEKGFRIVS GGTDTHLMLV DVFQKGMLGS EAEHALGEAG ITVNKNAIPY DTNPPMKPSG       360
     IRIGTPALTT RGMKEAEMLV IAGWIVRALE QRSDPAALAK IRGEVLELAE QFPLYEYLRA       420
     QA                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page