(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE34

ACIDO1_5.PE34        Location/Qualifiers
FT   CDS             37369..37845
FT                   /locus_tag="AciX9_0034"
FT                   /gene_family="HOG000070306" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:ACP_0844"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_0844 hypothetical protein"
FT                   /db_xref="GI:322433693"
FT                   /db_xref="GeneID:10202007"
FT                   /translation="MLAWMIAIPALGFMTGLRSMMPMAVLCWFAYLHHMPIHHSWAFWV
FT                   ASPISVGVFSVLAVGELIGDKLPMTPARTAIGPLVARICFGGLVGTIAAMSLRGAPVEG
FT                   LLLGVLGALAGSFLGYHIRIWLTKDFGWPDLIVALAEDIIAIVVSVYAMGIVTG"
FT                   /protein_id="YP_004215905.1"
     MLAWMIAIPA LGFMTGLRSM MPMAVLCWFA YLHHMPIHHS WAFWVASPIS VGVFSVLAVG        60
     ELIGDKLPMT PARTAIGPLV ARICFGGLVG TIAAMSLRGA PVEGLLLGVL GALAGSFLGY       120
     HIRIWLTKDF GWPDLIVALA EDIIAIVVSV YAMGIVTG                               158
//

If you have problems or comments...

PBIL Back to PBIL home page