(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE35

ACIDO1_5.PE35        Location/Qualifiers
FT   CDS             complement(37914..39794)
FT                   /locus_tag="AciX9_0035"
FT                   /gene_family="HOG000283740" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05960"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF885"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   xac:XAC2543 hypothetical protein"
FT                   /db_xref="GI:322433694"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="GeneID:10202008"
FT                   /translation="MRAPRVLVAVSMLSAVALATAQAPAMKPATAKPATTAKPAMTTAP
FT                   AAKTEDSNPAPISPFPQGPPSKPGLELKTIHTEDRKWREAQRGYVDPRRMNRIQPKELR
FT                   SVDAATQAKEYDHLKGVMAQLEKLPVAEMNESEKINLEIYRYQIESQMSGQYFKEWEKP
FT                   VSSLESFWANAQGTGERGFRTEQDYLNYLTWLADIPRYYDENIANMRAGLARGFTPPKI
FT                   TLNGRDQTIAPIAKATSADQTPFWKAFVHMPSTINTAEQARLRAEGKKVIESTVIPEYK
FT                   KLLPFWTDEYYPKTVTSIAATDLPDGKAYYKAQIKRYTTLDLSADDLHAFGIAEVAKIH
FT                   QEMLDTMVEAKFTGDFAAFQKFLRTDPQFYPKTKEELLGDVSYMMKEFDDKSDRYFGYQ
FT                   PRGRFGVHPVPDEVAPYQPAGFGGAGGFSINLYDLPSRPLYGMPALVLHEAAPGHSWAG
FT                   LIAREHADPDGFRGGGSAFGEGWALYCERLGTEMDMYHTPYEKFGMLSFQSWRASRLVV
FT                   DTGMHAMGWTREQGQQYLRDNTVLSEHDIEEEIDRYISWPGQALSYYMGMTEILKERKH
FT                   AQEVLGPKFNLRAFHDAILATGGLPLPVLDEYLEAWIKGGGIGPYPEMEK"
FT                   /protein_id="YP_004215906.1"
     MRAPRVLVAV SMLSAVALAT AQAPAMKPAT AKPATTAKPA MTTAPAAKTE DSNPAPISPF        60
     PQGPPSKPGL ELKTIHTEDR KWREAQRGYV DPRRMNRIQP KELRSVDAAT QAKEYDHLKG       120
     VMAQLEKLPV AEMNESEKIN LEIYRYQIES QMSGQYFKEW EKPVSSLESF WANAQGTGER       180
     GFRTEQDYLN YLTWLADIPR YYDENIANMR AGLARGFTPP KITLNGRDQT IAPIAKATSA       240
     DQTPFWKAFV HMPSTINTAE QARLRAEGKK VIESTVIPEY KKLLPFWTDE YYPKTVTSIA       300
     ATDLPDGKAY YKAQIKRYTT LDLSADDLHA FGIAEVAKIH QEMLDTMVEA KFTGDFAAFQ       360
     KFLRTDPQFY PKTKEELLGD VSYMMKEFDD KSDRYFGYQP RGRFGVHPVP DEVAPYQPAG       420
     FGGAGGFSIN LYDLPSRPLY GMPALVLHEA APGHSWAGLI AREHADPDGF RGGGSAFGEG       480
     WALYCERLGT EMDMYHTPYE KFGMLSFQSW RASRLVVDTG MHAMGWTREQ GQQYLRDNTV       540
     LSEHDIEEEI DRYISWPGQA LSYYMGMTEI LKERKHAQEV LGPKFNLRAF HDAILATGGL       600
     PLPVLDEYLE AWIKGGGIGP YPEMEK                                            626
//

If you have problems or comments...

PBIL Back to PBIL home page