(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE36

ACIDO1_5.PE36        Location/Qualifiers
FT   CDS             complement(39963..40490)
FT                   /locus_tag="AciX9_0036"
FT                   /gene_family="HOG000167971" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01352"
FT                   /codon_start="1"
FT                   /product="TonB family protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: TonB family protein; KEGG: aba:Acid345_0676
FT                   TonB-like protein"
FT                   /db_xref="GI:322433695"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="GeneID:10202009"
FT                   /translation="MSSLKMASVVLHVVVVAALLYKVQGVAKAHRAKSVARVLVPYAPG
FT                   HTAAAQPPKPKIIRPKVEPKIALKEPEPPPPASGGDPTGEADVSVAMANFYPAPKPDLS
FT                   ELPHGTHGDIVVDVTIDEDGKVVYTHVDEGLGHGVDEAVLAVLQTWTFYPATKAGKPVA
FT                   SVQQLLFHFDRA"
FT                   /protein_id="YP_004215907.1"
     MSSLKMASVV LHVVVVAALL YKVQGVAKAH RAKSVARVLV PYAPGHTAAA QPPKPKIIRP        60
     KVEPKIALKE PEPPPPASGG DPTGEADVSV AMANFYPAPK PDLSELPHGT HGDIVVDVTI       120
     DEDGKVVYTH VDEGLGHGVD EAVLAVLQTW TFYPATKAGK PVASVQQLLF HFDRA            175
//

If you have problems or comments...

PBIL Back to PBIL home page