(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE37

ACIDO1_5.PE37        Location/Qualifiers
FT   CDS             40734..44015
FT                   /locus_tag="AciX9_0037"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /codon_start="1"
FT                   /product="transglutaminase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transglutaminase domain-containing protein;
FT                   KEGG: aba:Acid345_3005 TPR repeat-containing protein"
FT                   /db_xref="GI:322433696"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="GeneID:10202010"
FT                   /translation="MQTSHLSSTLFLCFASFVSATLPAQQLPADVTVQKLPISPPPSSP
FT                   ASAASEYAGESAVVDRSELIYAMNADGTGYSEHSMAIRVQSEAAVRELGIVNVPFASAS
FT                   EKVEIQYVRVRRPDGTVLQTAVSAALEQPQAVTREAPFYSDLKQMQLPVKSLRAGDTLE
FT                   WKVRITRTKAEAPGQFWSQDTFVSQGIALSETLELRIPKDTSVNVWTNPALNLKPIEKV
FT                   DGNQHVYRWESKSLKPTTGPEAEAEKKRKEKELWTADQELDAKEGALPSVAWTTFKSWE
FT                   AVGAWYRGLEGDRMMPDDTLKAKVAELTAGKTTLEEKVRAVYGFVGPQVRYIGVAFGVG
FT                   RYQPHHAEEVLENQYGDCKDKHTLLAAMLTVLGLHPDAVLIGSGIRFNEAVPSPAAFNH
FT                   LITHVMIDGKETWLDTTAEVAPYRMLNSTIRDKQALVVPETGTAKLEKTPADPPFPSYQ
FT                   RLKAVGMLDQDGVSNSRLVLTVRGDDELVLRAVLHQIAPAQYDELTQRVSQSMGYGGTA
FT                   SHAEISRPEDTAGPLEMSYDYKREKAGDWNNYRIVAQLMPVSLPMVDEKDPPVQSIDLG
FT                   VPRILSSTAEMKLPSGWGVELPEAIHEKAAFATYDMSFRFDKGTLYSERKVVVLQQKIG
FT                   VKDWKSYKKWQDAVGLGGDPFIQLTRVDARTDHASGKEGGTSNGPPAPAVTNAEAVKLI
FT                   QQAFTAMRKMDVGEAQPLLDKAKGLNDQERLLWAGYGYLAELRGAEQEAATDYRKELSL
FT                   HPDSYQVYRSLVGSQLRSGKRKDAMETLRSWQTADTSDPAPAMQLSAMQLADGNASAAV
FT                   ETMNSSIAKLPEEKRTEPRVILALCQAEMKNGMEAKASASMLELLKTSEDSGVLNDAAY
FT                   FLSETGHELPASETAMHKALSQMNAETESWTLDESPQVLAQQTSLLIAAWDTMGWILFH
FT                   EGKLSEARSYVEAAWVNEGHAVVGEHLGDIQMAMGEFTLAIQTFELAKKGGGPASELNE
FT                   RQNNAKKAGGKSTSMDAGKELKELRTVKLGSSKGHDGAAEYKVLLADEKVVRVEATGAK
FT                   TVEGGAEMIEKMQLPQMFPKGSTARLAKSGLLDCYEETCAFIFKP"
FT                   /protein_id="YP_004215908.1"
     MQTSHLSSTL FLCFASFVSA TLPAQQLPAD VTVQKLPISP PPSSPASAAS EYAGESAVVD        60
     RSELIYAMNA DGTGYSEHSM AIRVQSEAAV RELGIVNVPF ASASEKVEIQ YVRVRRPDGT       120
     VLQTAVSAAL EQPQAVTREA PFYSDLKQMQ LPVKSLRAGD TLEWKVRITR TKAEAPGQFW       180
     SQDTFVSQGI ALSETLELRI PKDTSVNVWT NPALNLKPIE KVDGNQHVYR WESKSLKPTT       240
     GPEAEAEKKR KEKELWTADQ ELDAKEGALP SVAWTTFKSW EAVGAWYRGL EGDRMMPDDT       300
     LKAKVAELTA GKTTLEEKVR AVYGFVGPQV RYIGVAFGVG RYQPHHAEEV LENQYGDCKD       360
     KHTLLAAMLT VLGLHPDAVL IGSGIRFNEA VPSPAAFNHL ITHVMIDGKE TWLDTTAEVA       420
     PYRMLNSTIR DKQALVVPET GTAKLEKTPA DPPFPSYQRL KAVGMLDQDG VSNSRLVLTV       480
     RGDDELVLRA VLHQIAPAQY DELTQRVSQS MGYGGTASHA EISRPEDTAG PLEMSYDYKR       540
     EKAGDWNNYR IVAQLMPVSL PMVDEKDPPV QSIDLGVPRI LSSTAEMKLP SGWGVELPEA       600
     IHEKAAFATY DMSFRFDKGT LYSERKVVVL QQKIGVKDWK SYKKWQDAVG LGGDPFIQLT       660
     RVDARTDHAS GKEGGTSNGP PAPAVTNAEA VKLIQQAFTA MRKMDVGEAQ PLLDKAKGLN       720
     DQERLLWAGY GYLAELRGAE QEAATDYRKE LSLHPDSYQV YRSLVGSQLR SGKRKDAMET       780
     LRSWQTADTS DPAPAMQLSA MQLADGNASA AVETMNSSIA KLPEEKRTEP RVILALCQAE       840
     MKNGMEAKAS ASMLELLKTS EDSGVLNDAA YFLSETGHEL PASETAMHKA LSQMNAETES       900
     WTLDESPQVL AQQTSLLIAA WDTMGWILFH EGKLSEARSY VEAAWVNEGH AVVGEHLGDI       960
     QMAMGEFTLA IQTFELAKKG GGPASELNER QNNAKKAGGK STSMDAGKEL KELRTVKLGS      1020
     SKGHDGAAEY KVLLADEKVV RVEATGAKTV EGGAEMIEKM QLPQMFPKGS TARLAKSGLL      1080
     DCYEETCAFI FKP                                                         1093
//

If you have problems or comments...

PBIL Back to PBIL home page