(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE38

ACIDO1_5.PE38        Location/Qualifiers
FT   CDS             complement(44027..46171)
FT                   /locus_tag="AciX9_0038"
FT                   /gene_family="HOG000086847" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01056"
FT                   /codon_start="1"
FT                   /product="DNA topoisomerase III"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA topoisomerase III; PFAM: DNA
FT                   topoisomerase type IA central domain protein; TOPRIM
FT                   domain-containing protein; DNA topoisomerase type IA zn
FT                   finger domain protein; KEGG: drm:Dred_0974 DNA
FT                   topoisomerase III; SMART: DNA topoisomerase I DNA-binding;
FT                   DNA topoisomerase I ATP-binding; Toprim sub
FT                   domain-containing protein"
FT                   /db_xref="GI:322433697"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003916"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006154"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="GeneID:10202011"
FT                   /translation="MRVFLAEKPSVAREIAQALGCTHKEQGFFRGKNDLVTWAIGHLVR
FT                   FAEPGEMNPAWGKPWRREALPMLPKDGGWLLIPEPRTEDQFNVVARLFGDKRITQIVNA
FT                   TDAGREGEAIFRRIYALSGASKPVLRFWTSSLTEEAIASALSHLRPAADYDNLASAALT
FT                   RAQLDWLIGMNHSRAATLHNSVTCSVGRVQTPTLAMIVRRHHEIAGFIKTFFYEVHADL
FT                   GEFVARAVNSQQKHDFEIKAEAETILRDVPSDTLATVTLVEVKKNRKAPPQLHNLGELQ
FT                   KEANRRFGFPADRTLAIAQSLYESKAITYPRSSSRHLSEDMVDGLPAVLKALRLGEERA
FT                   SYVKQALHRAQHGPALSKRFVDGSKLSDHHAIIPTAKPAPASLSGDERKVYTIVAERFL
FT                   AIFLPDKETEDTRIDLEIAKHPFRARGSRLIAPGWTVLTGNQDFENKAADAEDRQALPA
FT                   VKKGDELEVVESELVTKERKPPSRYTDATLLAAMETAGREIDDDELREAMKGRGLGTEA
FT                   TRAAIIQRLLDLAYVIRDGKQFEPTGKGIALIAQVLPHLASPELTGDMEAKLNLVEAGQ
FT                   LDAAEILAEVSESLRHEIPAVFRSKPMQAPDAPRITAGKDELLCPKCKAGLVTKRSTPN
FT                   ASAPFYGCARFHDGCNFTINTVVAKKTLTETNIKDLCSPTRHHTTKIIKGFTSKAGKKF
FT                   DAFLQLSSATDFKTEFVFPR"
FT                   /protein_id="YP_004215909.1"
     MRVFLAEKPS VAREIAQALG CTHKEQGFFR GKNDLVTWAI GHLVRFAEPG EMNPAWGKPW        60
     RREALPMLPK DGGWLLIPEP RTEDQFNVVA RLFGDKRITQ IVNATDAGRE GEAIFRRIYA       120
     LSGASKPVLR FWTSSLTEEA IASALSHLRP AADYDNLASA ALTRAQLDWL IGMNHSRAAT       180
     LHNSVTCSVG RVQTPTLAMI VRRHHEIAGF IKTFFYEVHA DLGEFVARAV NSQQKHDFEI       240
     KAEAETILRD VPSDTLATVT LVEVKKNRKA PPQLHNLGEL QKEANRRFGF PADRTLAIAQ       300
     SLYESKAITY PRSSSRHLSE DMVDGLPAVL KALRLGEERA SYVKQALHRA QHGPALSKRF       360
     VDGSKLSDHH AIIPTAKPAP ASLSGDERKV YTIVAERFLA IFLPDKETED TRIDLEIAKH       420
     PFRARGSRLI APGWTVLTGN QDFENKAADA EDRQALPAVK KGDELEVVES ELVTKERKPP       480
     SRYTDATLLA AMETAGREID DDELREAMKG RGLGTEATRA AIIQRLLDLA YVIRDGKQFE       540
     PTGKGIALIA QVLPHLASPE LTGDMEAKLN LVEAGQLDAA EILAEVSESL RHEIPAVFRS       600
     KPMQAPDAPR ITAGKDELLC PKCKAGLVTK RSTPNASAPF YGCARFHDGC NFTINTVVAK       660
     KTLTETNIKD LCSPTRHHTT KIIKGFTSKA GKKFDAFLQL SSATDFKTEF VFPR             714
//

If you have problems or comments...

PBIL Back to PBIL home page