(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE39

ACIDO1_5.PE39        Location/Qualifiers
FT   CDS             46312..47112
FT                   /locus_tag="AciX9_0039"
FT                   /gene_family="HOG000167590" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Acid_2539"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_2539 hypothetical protein"
FT                   /db_xref="GI:322433698"
FT                   /db_xref="GeneID:10202012"
FT                   /translation="MMGRFGIALLLVLGASVGILRGQGTAAPGAIGDAPLLPEYREAPL
FT                   PPAYGGVQVRIPGIYVTPVVNAPFTAKVQIVSQEQLPDGTVRVRKTVNHIARQSSGRIY
FT                   NERRQLVAPTFQGEPRLISAHIYDPSTRLNTYLNPVTHIAQEIRMKQAAVAPNYGTTRM
FT                   GVGKNPLLKEEELGEQALGPVMLRGIRRSRTVPAAVSGTGKDVVVVDEYWYSAELEIYM
FT                   IIKHNDPRTGEQIVAVSDVERGEPDGKQFVVPGNYKRVDETPVD"
FT                   /protein_id="YP_004215910.1"
     MMGRFGIALL LVLGASVGIL RGQGTAAPGA IGDAPLLPEY REAPLPPAYG GVQVRIPGIY        60
     VTPVVNAPFT AKVQIVSQEQ LPDGTVRVRK TVNHIARQSS GRIYNERRQL VAPTFQGEPR       120
     LISAHIYDPS TRLNTYLNPV THIAQEIRMK QAAVAPNYGT TRMGVGKNPL LKEEELGEQA       180
     LGPVMLRGIR RSRTVPAAVS GTGKDVVVVD EYWYSAELEI YMIIKHNDPR TGEQIVAVSD       240
     VERGEPDGKQ FVVPGNYKRV DETPVD                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page