(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE4

ACIDO1_5.PE4         Location/Qualifiers
FT   CDS             4437..5207
FT                   /locus_tag="AciX9_0004"
FT                   /gene_family="HOG000115862" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Acid_5553"
FT                   /codon_start="1"
FT                   /product="peptidase M56, BlaR1"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_5553 peptidase M56, BlaR1"
FT                   /db_xref="GI:322433663"
FT                   /db_xref="InterPro:IPR017801"
FT                   /db_xref="GeneID:10201977"
FT                   /translation="MVKLEAWRWVAVTCFGLTAYGFSQEKATPLTFEVATVRLTKPGEL
FT                   DGWIKALPGGAEYTAHNIPVKLMISLMYKVPMRQISGGPDWMETDKYDVEAKADKSYSL
FT                   DDLHTMYRGLLAERFHLKVRKEIHEGPVYALTVDKGGVKMKPDLSEQSYAIPITYSGEG
FT                   AVGNRVPMSYLSWWLGQQLQSESRPVVDETGLKENFDFTLSFTPPRLEGTDGGAAEKPS
FT                   LFTAVKEQLGLKLEAQKGPVEYYVIEHIERPSAN"
FT                   /protein_id="YP_004215875.1"
     MVKLEAWRWV AVTCFGLTAY GFSQEKATPL TFEVATVRLT KPGELDGWIK ALPGGAEYTA        60
     HNIPVKLMIS LMYKVPMRQI SGGPDWMETD KYDVEAKADK SYSLDDLHTM YRGLLAERFH       120
     LKVRKEIHEG PVYALTVDKG GVKMKPDLSE QSYAIPITYS GEGAVGNRVP MSYLSWWLGQ       180
     QLQSESRPVV DETGLKENFD FTLSFTPPRL EGTDGGAAEK PSLFTAVKEQ LGLKLEAQKG       240
     PVEYYVIEHI ERPSAN                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page