(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE40

ACIDO1_5.PE40        Location/Qualifiers
FT   CDS             complement(47131..47367)
FT                   /locus_tag="AciX9_0040"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Sala_0857"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sal:Sala_0857 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="GI:322433699"
FT                   /db_xref="GeneID:10202013"
FT                   /translation="MMLTTIRIRVLHGIEELILDQPGVTSIPALGDSVSCFGTRAIVTG
FT                   STIVHTPEGHRSILLHAEMQSRILNAWSRLYSA"
FT                   /protein_id="YP_004215911.1"
     MMLTTIRIRV LHGIEELILD QPGVTSIPAL GDSVSCFGTR AIVTGSTIVH TPEGHRSILL        60
     HAEMQSRILN AWSRLYSA                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page