(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE41

ACIDO1_5.PE41        Location/Qualifiers
FT   CDS             47772..48392
FT                   /locus_tag="AciX9_0041"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:MXAN_0458"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mxa:MXAN_0458 hypothetical protein"
FT                   /db_xref="GI:322433700"
FT                   /db_xref="GeneID:10202014"
FT                   /translation="MPALGLVWLLAMVPGVRYLLAYEHTAGSQGTAPRGWPKGMPQVGD
FT                   AALPTLVVALHPRCSCSQATLAELEEAAQGFGHPYNAVLLIYRPKGSDYEWQKVDLYRD
FT                   AQKALHARVMLDDDGQYSAAFGAETSGEVLYYSAAKGAAGRRLLFSGGVTGSRGMVGGN
FT                   DGIEALKSAFKLDREPEHAKTPVFGCGLFAALEPQAAEKRSRP"
FT                   /protein_id="YP_004215912.1"
     MPALGLVWLL AMVPGVRYLL AYEHTAGSQG TAPRGWPKGM PQVGDAALPT LVVALHPRCS        60
     CSQATLAELE EAAQGFGHPY NAVLLIYRPK GSDYEWQKVD LYRDAQKALH ARVMLDDDGQ       120
     YSAAFGAETS GEVLYYSAAK GAAGRRLLFS GGVTGSRGMV GGNDGIEALK SAFKLDREPE       180
     HAKTPVFGCG LFAALEPQAA EKRSRP                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page