(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE42

ACIDO1_5.PE42        Location/Qualifiers
FT   CDS             48389..50395
FT                   /locus_tag="AciX9_0042"
FT                   /gene_family="HOG000167947" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; KEGG:
FT                   pca:Pcar_2937 signal transduction protein; SMART: EAL
FT                   domain protein; GGDEF domain containing protein"
FT                   /db_xref="GI:322433701"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="GeneID:10202015"
FT                   /translation="MNPSILSSERVTSVNVAKEAERLFRSEHRLVCTRTDRLFAILMSL
FT                   QWPAAVAAALLISSRTWVGGTSSVHPHLIAAVYLGGLITVPPVLLAFFRPGERYTRHII
FT                   AACQMLMSGLLIHVSGGRIETHFHVFGSLAFLAFYLDWEVLATATLVTLVDHLAMGYYL
FT                   PASIFGTATASHWRLLEHVLWVVFFDIFLITSCVQGLKWLHAVARREADQELLLYQAYH
FT                   DALTGLGNRLQIQKLMGELLMPGSKEPRPFALMAIDLDRFKEVNDTLGHQVGDELLRQV
FT                   SQRLMAQIRKNDTLVRMGGDEFALVLDGCTSARVAESIAGRMVESLNKPFSLGDHTARI
FT                   GASIGICLHLDEGQDATDLFHHADLALYKVKNSGRNSFMVFDENMRAETLHQMSMEHRL
FT                   RSAVLENQMHLHYQPIVSTEGRLLGFEALLRWNDAVHGDVSPVDFIPLAEKTGLIIPLG
FT                   AWVLQQACSQAAQWHRTGNKLMKMSVNVSSIQLAHKDFVTTVLTALKETGLPAELLDLE
FT                   LTESALIQQHDSSYESLHLLRRFGVKLSIDDFGTGYSSLSYLRDLPVHTLKIDRAFVKD
FT                   IEISPESRTLVEGMIDMAHTLHLRVVAEGVENRKQMEILVEAGCDEIQGFHISKAVPAD
FT                   DARRFINVSHGEPEIKAMAGAAKVRGLAEVLAR"
FT                   /protein_id="YP_004215913.1"
     MNPSILSSER VTSVNVAKEA ERLFRSEHRL VCTRTDRLFA ILMSLQWPAA VAAALLISSR        60
     TWVGGTSSVH PHLIAAVYLG GLITVPPVLL AFFRPGERYT RHIIAACQML MSGLLIHVSG       120
     GRIETHFHVF GSLAFLAFYL DWEVLATATL VTLVDHLAMG YYLPASIFGT ATASHWRLLE       180
     HVLWVVFFDI FLITSCVQGL KWLHAVARRE ADQELLLYQA YHDALTGLGN RLQIQKLMGE       240
     LLMPGSKEPR PFALMAIDLD RFKEVNDTLG HQVGDELLRQ VSQRLMAQIR KNDTLVRMGG       300
     DEFALVLDGC TSARVAESIA GRMVESLNKP FSLGDHTARI GASIGICLHL DEGQDATDLF       360
     HHADLALYKV KNSGRNSFMV FDENMRAETL HQMSMEHRLR SAVLENQMHL HYQPIVSTEG       420
     RLLGFEALLR WNDAVHGDVS PVDFIPLAEK TGLIIPLGAW VLQQACSQAA QWHRTGNKLM       480
     KMSVNVSSIQ LAHKDFVTTV LTALKETGLP AELLDLELTE SALIQQHDSS YESLHLLRRF       540
     GVKLSIDDFG TGYSSLSYLR DLPVHTLKID RAFVKDIEIS PESRTLVEGM IDMAHTLHLR       600
     VVAEGVENRK QMEILVEAGC DEIQGFHISK AVPADDARRF INVSHGEPEI KAMAGAAKVR       660
     GLAEVLAR                                                                668
//

If you have problems or comments...

PBIL Back to PBIL home page