(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE43

ACIDO1_5.PE43        Location/Qualifiers
FT   CDS             50466..50993
FT                   /locus_tag="AciX9_0043"
FT                   /gene_family="HOG000020479" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /codon_start="1"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   aca:ACP_0848 cupin domain protein"
FT                   /db_xref="GI:322433702"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="GeneID:10202016"
FT                   /translation="MAEATAVPADDLQRYLKLAQPDGDVKLPHLGVVGDTYTLLLTGKD
FT                   TAGRLSLIDMHVPPGGGPPPHRHDFEETFIVLDGELSAIFRGQKMAVKAGETVHIPSNA
FT                   PHQFHNSSDKPVRMLCICSPAGQEEMFLEIGVPVATRTTAPPPLSEDEQKAFRAQAEAL
FT                   APKYKTELLAHA"
FT                   /protein_id="YP_004215914.1"
     MAEATAVPAD DLQRYLKLAQ PDGDVKLPHL GVVGDTYTLL LTGKDTAGRL SLIDMHVPPG        60
     GGPPPHRHDF EETFIVLDGE LSAIFRGQKM AVKAGETVHI PSNAPHQFHN SSDKPVRMLC       120
     ICSPAGQEEM FLEIGVPVAT RTTAPPPLSE DEQKAFRAQA EALAPKYKTE LLAHA            175
//

If you have problems or comments...

PBIL Back to PBIL home page