(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE44

ACIDO1_5.PE44        Location/Qualifiers
FT   CDS             51033..51971
FT                   /locus_tag="AciX9_0044"
FT                   /gene_family="HOG000004695" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /codon_start="1"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: sus:Acid_4915 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="GI:322433703"
FT                   /db_xref="GO:0008889"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="GeneID:10202017"
FT                   /translation="MLKKIAGVMLMGVVSALAQTNAVRNTPRTILVHAHRGGRALRPEN
FT                   TIPSFQHGIDVGADVLELDLAVTKDGVLVVSHSPYLTYPVDTDVAKERVCDGPALPPGT
FT                   AIHTLTLAQLKQYDCGLHPLKRFPKQMAVPHTTIPTFDEVLELAPQGTFQFNVETKIYP
FT                   NHPELTPAPEAFVKMIDDAVKRRHLQARVILQSFDFRTLHAMRAIDPAIRLSALFEAKD
FT                   DGFTGIADQDKSFAHIAKVSGAEILSPDQTLVTPEAVATAHAMGRQVAPFTVNTSEGWQ
FT                   KMADAKVDAIISDDPVALLAWLRAQNPPLHP"
FT                   /protein_id="YP_004215915.1"
     MLKKIAGVML MGVVSALAQT NAVRNTPRTI LVHAHRGGRA LRPENTIPSF QHGIDVGADV        60
     LELDLAVTKD GVLVVSHSPY LTYPVDTDVA KERVCDGPAL PPGTAIHTLT LAQLKQYDCG       120
     LHPLKRFPKQ MAVPHTTIPT FDEVLELAPQ GTFQFNVETK IYPNHPELTP APEAFVKMID       180
     DAVKRRHLQA RVILQSFDFR TLHAMRAIDP AIRLSALFEA KDDGFTGIAD QDKSFAHIAK       240
     VSGAEILSPD QTLVTPEAVA TAHAMGRQVA PFTVNTSEGW QKMADAKVDA IISDDPVALL       300
     AWLRAQNPPL HP                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page