(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE45

ACIDO1_5.PE45        Location/Qualifiers
FT   CDS             complement(51989..52642)
FT                   /locus_tag="AciX9_0045"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /codon_start="1"
FT                   /product="pentapeptide repeat protein"
FT                   /transl_table="11"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   clj:CLJU_c15620 hypothetical protein"
FT                   /db_xref="GI:322433704"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="GeneID:10202018"
FT                   /translation="MAPKPKSRQAPQIDHDILTEDFAAQLDSGAVHDALAADTTLPPFV
FT                   SPRGQSARLDRCLWRNVTLTAPNARGLRLYDTQIEGSDLANLDLTGGHLERVEITGTRL
FT                   TGATFTEAQLKSVLFRECKLDLAFFRMARLQHCVFERCNLTDADLYNADLTGTIFKDCD
FT                   LSRAELSHAKLIQADVRDCRLDGLRGTPADMAGLMISPDQAPQLITLFGVKVKW"
FT                   /protein_id="YP_004215916.1"
     MAPKPKSRQA PQIDHDILTE DFAAQLDSGA VHDALAADTT LPPFVSPRGQ SARLDRCLWR        60
     NVTLTAPNAR GLRLYDTQIE GSDLANLDLT GGHLERVEIT GTRLTGATFT EAQLKSVLFR       120
     ECKLDLAFFR MARLQHCVFE RCNLTDADLY NADLTGTIFK DCDLSRAELS HAKLIQADVR       180
     DCRLDGLRGT PADMAGLMIS PDQAPQLITL FGVKVKW                                217
//

If you have problems or comments...

PBIL Back to PBIL home page