(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE5

ACIDO1_5.PE5         Location/Qualifiers
FT   CDS             5242..6834
FT                   /locus_tag="AciX9_0005"
FT                   /gene_family="HOG000167948" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /codon_start="1"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; GAF domain protein; PAS
FT                   fold-3 domain protein; histidine kinase A domain protein;
FT                   KEGG: aca:ACP_0498 sensory box histidine kinase/response
FT                   regulator; SMART: ATP-binding region ATPase domain protein;
FT                   GAF domain protein; histidine kinase A domain protein"
FT                   /db_xref="GI:322433664"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="GeneID:10201978"
FT                   /translation="MGSTNRPDSTAEDRRLEALRQFSILDTLPEQGYEDVTELASFICG
FT                   TPIALVSLVDAERQWFKSVRGLEARETPVSQSFCAYTVPTGETLIVTDARTDERFKNNP
FT                   LVLGDPNIRFYAGAPIVEANGYVLGTVCVIDTEPRELSAKQVRALEALARQVMSMMELR
FT                   KAIAAEAKATETTRLAQESAKIASWEWEVESGRLSWSGDSAWIYGRPAEELAHIDQVLP
FT                   CVHEEDLHVLQGSMADSLAGGGEFQNEFRVVWPDGSTHLIVGQGSTVLKASGEVARVVG
FT                   INRDVTQRRLTEEALRQSEKLAAVGRLASTIAHEMNNPLESVTNLLYLAMTSGTLSEEA
FT                   HTYLSTAERELRRVSAIANQTLRFHKQSSKPQRVSCEDLFESALLIHQGRIVNSGVAVQ
FT                   KRKRATETVLCFDGEIRQVLNNLLGNAIDAMSAGEGRLVIRSRNATDWVSGRKGLMLTV
FT                   ADTGAGMSAATQKRLFDAFFTTKGIGGTGLGLWVSKEIVERHGGALRVRSSQAEGHRGT
FT                   VFCLFLPFDAVAR"
FT                   /protein_id="YP_004215876.1"
     MGSTNRPDST AEDRRLEALR QFSILDTLPE QGYEDVTELA SFICGTPIAL VSLVDAERQW        60
     FKSVRGLEAR ETPVSQSFCA YTVPTGETLI VTDARTDERF KNNPLVLGDP NIRFYAGAPI       120
     VEANGYVLGT VCVIDTEPRE LSAKQVRALE ALARQVMSMM ELRKAIAAEA KATETTRLAQ       180
     ESAKIASWEW EVESGRLSWS GDSAWIYGRP AEELAHIDQV LPCVHEEDLH VLQGSMADSL       240
     AGGGEFQNEF RVVWPDGSTH LIVGQGSTVL KASGEVARVV GINRDVTQRR LTEEALRQSE       300
     KLAAVGRLAS TIAHEMNNPL ESVTNLLYLA MTSGTLSEEA HTYLSTAERE LRRVSAIANQ       360
     TLRFHKQSSK PQRVSCEDLF ESALLIHQGR IVNSGVAVQK RKRATETVLC FDGEIRQVLN       420
     NLLGNAIDAM SAGEGRLVIR SRNATDWVSG RKGLMLTVAD TGAGMSAATQ KRLFDAFFTT       480
     KGIGGTGLGL WVSKEIVERH GGALRVRSSQ AEGHRGTVFC LFLPFDAVAR                  530
//

If you have problems or comments...

PBIL Back to PBIL home page