(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE51

ACIDO1_5.PE51        Location/Qualifiers
FT   CDS             57160..58647
FT                   /locus_tag="AciX9_0051"
FT                   /gene_family="HOG000252249" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Slin_1343"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sli:Slin_1343 hypothetical protein"
FT                   /db_xref="GI:322433710"
FT                   /db_xref="GeneID:10202024"
FT                   /translation="MMIGENAQGYPRASLKDVPPGEYTVQAVLNVYETFQRGDGKMVKL
FT                   APDRGEGQHWNLAPGNLMSKPRKVKIGPGTMPITVSLDQVIPPNVPEKDTKYIRHIKVQ
FT                   SALLTRFWGRPMFLSAVVLVPEGFDTHTEAHYPLVIFHDHFVSGFSDFRETPPDAKLKA
FT                   DYSERFHLAGYNRIQQEEAYKNYKDWVAPNKPRMLIIKIQHANAYYDDSYAVNSENLGP
FT                   YGDAIETELIPAVEKEFRALGQGWARFVYGGSTGGWESLAVQMFYPEHYNGAFVACPDP
FT                   VDFHAFMTADLYKQDNLFYEQGANKRVEQPAMRNYLGQTLISMRDNVAYEAALGDSARS
FT                   GDQFDIWQAVYSPVGADGYPRPIFNKTTGTIDHTTAEYWRQHYDLNAILQRDWTKLGPK
FT                   LQGKIHLYVGSDDTYFLNNAVYLMEDFLKETGTPGHGVAYDGEVKYGPRAEHCWNGDPE
FT                   KPNWYSRLHYNQMYVPMILDRIAKTAPAGADVTSWKY"
FT                   /protein_id="YP_004215922.1"
     MMIGENAQGY PRASLKDVPP GEYTVQAVLN VYETFQRGDG KMVKLAPDRG EGQHWNLAPG        60
     NLMSKPRKVK IGPGTMPITV SLDQVIPPNV PEKDTKYIRH IKVQSALLTR FWGRPMFLSA       120
     VVLVPEGFDT HTEAHYPLVI FHDHFVSGFS DFRETPPDAK LKADYSERFH LAGYNRIQQE       180
     EAYKNYKDWV APNKPRMLII KIQHANAYYD DSYAVNSENL GPYGDAIETE LIPAVEKEFR       240
     ALGQGWARFV YGGSTGGWES LAVQMFYPEH YNGAFVACPD PVDFHAFMTA DLYKQDNLFY       300
     EQGANKRVEQ PAMRNYLGQT LISMRDNVAY EAALGDSARS GDQFDIWQAV YSPVGADGYP       360
     RPIFNKTTGT IDHTTAEYWR QHYDLNAILQ RDWTKLGPKL QGKIHLYVGS DDTYFLNNAV       420
     YLMEDFLKET GTPGHGVAYD GEVKYGPRAE HCWNGDPEKP NWYSRLHYNQ MYVPMILDRI       480
     AKTAPAGADV TSWKY                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page