(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE7

ACIDO1_5.PE7         Location/Qualifiers
FT   CDS             7371..7859
FT                   /locus_tag="AciX9_0007"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:HEAR0030"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: har:HEAR0030 putative pirin-related protein"
FT                   /db_xref="GI:322433666"
FT                   /db_xref="GeneID:10201980"
FT                   /translation="MKKLALVGLVLLMGCGPRLYSGKGVVAGSGGTLGNWSHPPAGCIR
FT                   DSAYQDEGQRSVATFLWKDLRILEPGPGYNDIWKNDTPIRLDLQRDGDGYTGVLRTFKQ
FT                   QLGWRIDKTACSEFEFTPHEGPAREPKGRPVLDGELKMDCAVAGGRLTANVSFKGCGY"
FT                   /protein_id="YP_004215878.1"
     MKKLALVGLV LLMGCGPRLY SGKGVVAGSG GTLGNWSHPP AGCIRDSAYQ DEGQRSVATF        60
     LWKDLRILEP GPGYNDIWKN DTPIRLDLQR DGDGYTGVLR TFKQQLGWRI DKTACSEFEF       120
     TPHEGPAREP KGRPVLDGEL KMDCAVAGGR LTANVSFKGC GY                          162
//

If you have problems or comments...

PBIL Back to PBIL home page