(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE8

ACIDO1_5.PE8         Location/Qualifiers
FT   CDS             7923..8957
FT                   /locus_tag="AciX9_0008"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Srot_2219"
FT                   /codon_start="1"
FT                   /product="phosphatidylserine/phosphatidylglycerophosphate/
FT                   cardiolipin synthase-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: srt:Srot_2219
FT                   phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
FT                   n synthase-like protein"
FT                   /db_xref="GI:322433667"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="GeneID:10201981"
FT                   /translation="MRSGLRVLGWMLIGVLAASAAGQAGTHSRHAGRVDTVTSGTRVLY
FT                   TFPQSNNSATPLYALVNGSLKTIDMTMYELVDTVFSADLVAACKRGVKVRVILDQNLEK
FT                   SSNTAAYNQLNKTTNCSAAWANPAFQATHQKSMIVDGTKLAIITLNLTTRYYTTSRDFA
FT                   LVETDAADIAAVEATFNADFKSTTSFAYQPGKGTDLIWSPTTATADLLGIINGATKTLL
FT                   VENEEMGAANVVSALEAACKRGVAVHVAMTNLTAYKTEFAALKAAGCGVHLYASTATGL
FT                   YIHAKVLVADYGLSTQMVYVGSINFSIPSMTDNRELGLYVSDATIVKALQTQVTTDYAG
FT                   APAL"
FT                   /protein_id="YP_004215879.1"
     MRSGLRVLGW MLIGVLAASA AGQAGTHSRH AGRVDTVTSG TRVLYTFPQS NNSATPLYAL        60
     VNGSLKTIDM TMYELVDTVF SADLVAACKR GVKVRVILDQ NLEKSSNTAA YNQLNKTTNC       120
     SAAWANPAFQ ATHQKSMIVD GTKLAIITLN LTTRYYTTSR DFALVETDAA DIAAVEATFN       180
     ADFKSTTSFA YQPGKGTDLI WSPTTATADL LGIINGATKT LLVENEEMGA ANVVSALEAA       240
     CKRGVAVHVA MTNLTAYKTE FAALKAAGCG VHLYASTATG LYIHAKVLVA DYGLSTQMVY       300
     VGSINFSIPS MTDNRELGLY VSDATIVKAL QTQVTTDYAG APAL                        344
//

If you have problems or comments...

PBIL Back to PBIL home page