(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE9

ACIDO1_5.PE9         Location/Qualifiers
FT   CDS             complement(8954..9523)
FT                   /locus_tag="AciX9_0009"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF10604"
FT                   /codon_start="1"
FT                   /product="Polyketide cyclase/dehydrase"
FT                   /transl_table="11"
FT                   /note="PFAM: Polyketide cyclase/dehydrase; KEGG:
FT                   rsl:RPSI07_3238 conserved hypothethical protein"
FT                   /db_xref="GI:322433668"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="GeneID:10201982"
FT                   /translation="MRMSSQAQTPDPTYDAQPSSPPTIRWPGLHQPSDAAIFASNEIVI
FT                   PAPIEAIWPWLIRAELWPTWYPYSANIHFISTSGPDLRDRTRFRWSKFGVPITSKVREF
FT                   EPLTRLAYDIHGIGVLAYQAWLLTPLPDGTTHVLTQEVQTGWLARIGKRIMPHRLEDKH
FT                   QHWLEALSVKAQSGPPAQPRPFLKES"
FT                   /protein_id="YP_004215880.1"
     MRMSSQAQTP DPTYDAQPSS PPTIRWPGLH QPSDAAIFAS NEIVIPAPIE AIWPWLIRAE        60
     LWPTWYPYSA NIHFISTSGP DLRDRTRFRW SKFGVPITSK VREFEPLTRL AYDIHGIGVL       120
     AYQAWLLTPL PDGTTHVLTQ EVQTGWLARI GKRIMPHRLE DKHQHWLEAL SVKAQSGPPA       180
     QPRPFLKES                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page