(data stored in ACNUC7421 zone)

HOGENOMDNA: ACISJ_3.PE3

ACISJ_3.PE3          Location/Qualifiers
FT   CDS             2149..4158
FT                   /locus_tag="Ajs_0003"
FT                   /gene_family="HOG000136246" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /transl_table="11"
FT                   /note="KEGG: tbd:Tbd_1042 putative diguanylate
FT                   cyclase/phosphodiesterase (GGDEF & EAL domains) with
FT                   PAS/PAC and GAF sensor(s); TIGRFAM: PAS sensor protein;
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   EAL domain protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="GI:121592439"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:4671061"
FT                   /translation="MVDGVAQPNAEYVLEGTPSERLLTQRSLVIRDRARERFPRAPVLA
FT                   RTGARSYVGQQLTASDGTPIGMIFVVFRQTLERSRFVSNTLQIFAARAAAELQRQTDDQ
FT                   RIRQQASLLDKARDAIIVRDLEHRITFWNEGAERMYGWSREEVLGRSIATLLYQNPEDF
FT                   LRATQQVMQHGVWSGEILQCDRAGRTLEAEGRWTLVRNDRGEPESVLAINADIGTRKHQ
FT                   EREIQRLAFFDPLTHLPNRVQLLDRVDQALAKAQRLEQGGALLFIDLDNFKTLNDTLGH
FT                   DQGDELLQIVAQRLNTCVRSADTVARLGGDEFVVLVEQLSAHSDTLAEQAGAVGEKILA
FT                   VLSAPYALTGYQHRSTPSIGIALFNHAPTTVGELLKQADLAMYQAKTAGRNTLRFFNPS
FT                   MQHAVAERASLEADLRNALAQKEFLLHYQPQINARGAIVGVEALLRWAHPRRGMVSPGQ
FT                   FIPLAEETGLVLPLGHWVLHTACSVLADWQRVPALAPLTMAVNVSSRQFRDAGFVDDVA
FT                   GVLAATGAPASQLKLELTESLLVEDLAATIATMAALRALGVGFSLDDFGTGYSSLAYLK
FT                   RMPLGQLKIDQSFVRDLLTDPNDAAIVRTIIGLAASLGLEVIAEGVETSAQRDWLAHAG
FT                   CAVYQGYFFSRPLPLDLLEQLLHDHIAAARTPSL"
FT                   /protein_id="YP_984335.1"
     MVDGVAQPNA EYVLEGTPSE RLLTQRSLVI RDRARERFPR APVLARTGAR SYVGQQLTAS        60
     DGTPIGMIFV VFRQTLERSR FVSNTLQIFA ARAAAELQRQ TDDQRIRQQA SLLDKARDAI       120
     IVRDLEHRIT FWNEGAERMY GWSREEVLGR SIATLLYQNP EDFLRATQQV MQHGVWSGEI       180
     LQCDRAGRTL EAEGRWTLVR NDRGEPESVL AINADIGTRK HQEREIQRLA FFDPLTHLPN       240
     RVQLLDRVDQ ALAKAQRLEQ GGALLFIDLD NFKTLNDTLG HDQGDELLQI VAQRLNTCVR       300
     SADTVARLGG DEFVVLVEQL SAHSDTLAEQ AGAVGEKILA VLSAPYALTG YQHRSTPSIG       360
     IALFNHAPTT VGELLKQADL AMYQAKTAGR NTLRFFNPSM QHAVAERASL EADLRNALAQ       420
     KEFLLHYQPQ INARGAIVGV EALLRWAHPR RGMVSPGQFI PLAEETGLVL PLGHWVLHTA       480
     CSVLADWQRV PALAPLTMAV NVSSRQFRDA GFVDDVAGVL AATGAPASQL KLELTESLLV       540
     EDLAATIATM AALRALGVGF SLDDFGTGYS SLAYLKRMPL GQLKIDQSFV RDLLTDPNDA       600
     AIVRTIIGLA ASLGLEVIAE GVETSAQRDW LAHAGCAVYQ GYFFSRPLPL DLLEQLLHDH       660
     IAAARTPSL                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page